Entry information : GmPrx273 (Glyma16g24610.1)
Entry ID 9009
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: GmPrx273 (Glyma16g24610.1)
Name (synonym) GmPrx273 (Glyma16g24610.1)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx273
start..stop
S start..stop
GmPrx27 634 0 1..331 1..331
RcPrx17 547 0 1..331 1..331
MtPrx25 546 0 1..330 1..330
NnPrx50 543 0 1..331 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28575819..28576043 225 N° 2 28575399..28575590 192 N° 3 28574991..28575156 166 N° 4 28574302..28574714 413
complement(join(28574302..28574714,28574991..28575156,28575399..28575590,2857581 9..28576043))


exon

Literature and cross-references GmPrx273 (Glyma16g24610.1)
DNA ref. Phytozome 12:   Gm16 (28576043..28574302)
Protein sequence: GmPrx273 (Glyma16g24610.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (309)
PWM (Da):   %s   36653.29 (34196.1)  
PI (pH):   %s   6.96 (6.98) Peptide Signal:   %s   cut: 23 range:23-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANSMSFFLLLSLLAFAPLCLCHYNQEGYLYPQFYDYSCPQVQHIVKSVLAKYVAEQPRLAASILRLHFHDCFVKGCDASLLLDSSVNIISEKGSNPNRNSARGFEVVDAIKAELERKCPSTVSCADILTLAARDSVVLTGGPSWEVPLGRRDSLGASISGSNNNIPAPNNTFQTILTKFNLQGLDLVDLVALSGGHTIGNARCTTFKQRLYNQSGNGEPDSTLDQYYAATLRNRCPSSGGDQNLFFLDYATPYKFDNSYFTNLLAYKGLLSSDQVLFTMNQESAELVKLYAERNDIFFEQFAKSMIKMGNISPLTNSKGEIRENCRRINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATTCCATGAGCTTTTTCCTGCTTCTTTCTTTACTAGCTTTTGCTCCCTTGTGCCTCTGTCACTATAACCAAGAGGGTTACCTCTACCCTCAGTTTTATGACTATTCATGCCCA
CAAGTTCAGCATATTGTCAAGTCTGTCCTTGCCAAGTATGTTGCAGAGCAACCTCGATTGGCGGCTTCAATTCTCAGGCTTCATTTCCATGATTGTTTTGTCAAG
GTCTCTCCCCATGAC
TTACTCATTTATTGCACAAAAACATCACATTATTAGCATTATAGTATCATAAATAATTATATGATGTTAGTACTTAGTCTTAATGGTAAACATAGTTATATTATGCAATGTGATGTTAGT
ACTTAGTATTAGTCTTATTGGTAAACATATATAGTTATGTTATATCCGGTTGCTTTTTCAAATGCATAATTCCAAGTTGATGTTGCAATGCAGGGTTGTGATGCTTCATTGTTGTTAGAT
AGCAGTGTAAACATCATCAGTGAGAAGGGATCAAATCCCAACCGTAATTCAGCTAGAGGATTTGAAGTCGTTGATGCAATTAAAGCCGAATTAGAGAGAAAATGCCCTTCTACTGTGTCT
TGTGCTGACATCTTGACTCTAGCTGCAAGAGATTCAGTTGTTCTT
GTAAGTGTCTCCTTTTGCTTTATACTTCAGGACTCTCCTTTATGGTGGATTTGATAACTTTGGTTTGAAAAAATG
TTTATCTTTACACTTTGATTTTTAATTACAAAAATACCACTTTGTTTTCATGTTATTTTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTATTTTCTCAAATTAAACCATCTCTT
AACCTTTCACTATCAAGCCTGATTCACTTTCCCTTTTTTGTATACAGACTGGTGGACCAAGCTGGGAAGTACCCTTAGGCAGAAGGGACTCACTAGGTGCAAGCATAAGTGGCTCCAACA
ACAACATCCCAGCCCCAAACAACACATTCCAGACCATTCTAACTAAATTCAACCTTCAGGGGCTTGATCTTGTTGATCTAGTTGCTCTATCAG
GTATACACTCTAAACTTTTCTGTTTCT
AGACTTTTGTGTTCAGGTTGAGTTATGGTTAAAAAAATTTATTGGTATGATCATCTAATCATATCATTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATATTATCACCATGTTGCCATGCACCAACTTGAATCAAAGTTAACTCAATTTCATATTCTAAAAAAATTTTGTGCAA
TTGCTCTAGGGGGACACACTATAGGAAATGCCAGGTGCACCACCTTCAAGCAAAGACTCTATAACCAAAGTGGCAATGGCGAGCCAGATTCTACTCTTGACCAATACTATGCTGCTACAT
TGCGTAATAGGTGTCCAAGCTCTGGGGGTGACCAGAATCTGTTCTTCCTAGACTATGCCACCCCATACAAATTTGACAACAGCTACTTCACGAACCTTTTGGCTTACAAGGGTCTCTTGA
GTTCTGATCAAGTCCTCTTCACAATGAACCAAGAATCAGCTGAACTAGTGAAGTTGTATGCTGAAAGAAACGACATTTTCTTTGAGCAATTCGCGAAGTCCATGATCAAGATGGGAAACA
TATCTCCTTTGACGAATTCAAAGGGAGAGATCAGAGAGAATTGCAGGAGGATTAACGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAATTCCATGAGCTTTTTCCTGCTTCTTTCTTTACTAGCTTTTGCTCCCTTGTGCCTCTGTCACTATAACCAAGAGGGTTACCTCTACCCTCAGTTTTATGACTATTCATGCCCA
CAAGTTCAGCATATTGTCAAGTCTGTCCTTGCCAAGTATGTTGCAGAGCAACCTCGATTGGCGGCTTCAATTCTCAGGCTTCATTTCCATGATTGTTTTGTCAAG
GGTTGTGATGCTTCA
TTGTTGTTAGATAGCAGTGTAAACATCATCAGTGAGAAGGGATCAAATCCCAACCGTAATTCAGCTAGAGGATTTGAAGTCGTTGATGCAATTAAAGCCGAATTAGAGAGAAAATGCCCT
TCTACTGTGTCTTGTGCTGACATCTTGACTCTAGCTGCAAGAGATTCAGTTGTTCTT
ACTGGTGGACCAAGCTGGGAAGTACCCTTAGGCAGAAGGGACTCACTAGGTGCAAGCATAAGT
GGCTCCAACAACAACATCCCAGCCCCAAACAACACATTCCAGACCATTCTAACTAAATTCAACCTTCAGGGGCTTGATCTTGTTGATCTAGTTGCTCTATCAG
GGGGACACACTATAGGA
AATGCCAGGTGCACCACCTTCAAGCAAAGACTCTATAACCAAAGTGGCAATGGCGAGCCAGATTCTACTCTTGACCAATACTATGCTGCTACATTGCGTAATAGGTGTCCAAGCTCTGGG
GGTGACCAGAATCTGTTCTTCCTAGACTATGCCACCCCATACAAATTTGACAACAGCTACTTCACGAACCTTTTGGCTTACAAGGGTCTCTTGAGTTCTGATCAAGTCCTCTTCACAATG
AACCAAGAATCAGCTGAACTAGTGAAGTTGTATGCTGAAAGAAACGACATTTTCTTTGAGCAATTCGCGAAGTCCATGATCAAGATGGGAAACATATCTCCTTTGACGAATTCAAAGGGA
GAGATCAGAGAGAATTGCAGGAGGATTAACGCTTGA

Retrieve as FASTA