Entry information : GmPrx274 (Glyma16g24640.1)
Entry ID 9010
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: GmPrx274 (Glyma16g24640.1)
Name (synonym) GmPrx274 (Glyma16g24640.1)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx274
start..stop
S start..stop
GmPrx[P]99 497 1e-179 15..317 1..304
GmPrx27 498 2e-179 1..326 1..331
GmPrx273 493 2e-177 1..326 1..331
RcPrx17 478 2e-171 1..326 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28596389..28596595 207 N° 2 28595948..28596139 192 N° 3 28595471..28595636 166 N° 4 28594625..28595040 416
complement(join(28594625..28595040,28595471..28595636,28595948..28596139,2859638 9..28596595))


exon

Literature and cross-references GmPrx274 (Glyma16g24640.1)
DNA ref. Phytozome 12:   Gm16 (28596595..28594625)
Protein sequence: GmPrx274 (Glyma16g24640.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   36102.98 (33651.7)  
PI (pH):   %s   5.38 (5.38) Peptide Signal:   %s   cut: 23 range:23-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVNSMSFLLLLSLLAFAPLCLCNLNPQFYDNSCPQAQQIAKSILTSYFVIQPGYAAQILRLHFHDCFVMGCDGSLLLDSSESIVSEKESDPNRDSARGFIVIDAIKLAIERACPSTVSCADILTIAARDSVVLTGGPSWEVPLGRRDSRDASISGSNNNIPAPNSIFPTLQTKFEQQGLNLTDLVTLSGAHTLGVARCTNFRQRLYNQSGNGQPDPTLDQNYAAFLRVTCPRTTLGDQNPFFLDYATPLKFDNSYFKNLMENKGLLNSDQILFTMNQESAELVRLYAERNDLFFEQFSKSMIKMGNISPLTNSSGEIRQNCRRVNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No EST. Incorrect prediction from phytozome (=>short PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAATTCCATGAGCTTTCTCCTGCTTCTTTCTTTACTAGCCTTTGCTCCCTTGTGCCTCTGTAACCTCAACCCTCAGTTTTATGACAATTCATGCCCTCAAGCTCAGCAAATTGCC
AAGTCCATTCTTACCTCGTATTTTGTAATTCAACCCGGATATGCGGCTCAAATTCTCAGGCTTCATTTCCATGATTGTTTTGTCATG
GTCTCTCCCTATGACTTGCCAACAGAATTAGTG
GTTTATTGCACAACAACATCACATTATTAACATTGTAGTATCATAAATAATTATATGATGTTAGTACTTAGTTTTATTGGTAACATAGTTGTATTATCATGTGATTGATCGATGTTAATA
CTTAGTACTTAGTCTTATTGGTAAACATATAATAGTTAATTATGTTATATCCAGTAGTTGTTTATTCAAATGCTTAATTCCAAGTTGATGTTGTAGGGATGTGATGGTTCATTGTTGTTA
GATAGCAGTGAAAGCATCGTCAGTGAGAAGGAATCAGATCCCAACCGTGATTCAGCTAGAGGATTTATAGTCATTGATGCAATTAAACTGGCGATAGAGAGAGCATGCCCTTCTACAGTG
TCTTGTGCTGACATCTTGACTATAGCTGCAAGAGATTCAGTTGTTCTT
GTAAGTATCTTATTATGAGAGATTCAGTTAATTGGTTTGAAAAAATGTTTTATATTTTTTTTTTAATTACAA
AAATACTATAAAAGTTTGTGCATCAAATAGTAAAATAAGTTTAATTTTTTTTTCCAGTTTTCCATACAAACATAAAATAAAGTAAAACAAAATGATATTTTTGTAATTAAAAGTGGAAAT
AAAAAATAAAAAAACAGAAAATGTTTTTTCAAATTAAACTGTTTCTAATTAACCTTTCATTATCAAGACTTTGTCATTTTTATCAAGCCTGAATCACTATATATCTCTTTTATGTATAGA
CTGGTGGACCAAGCTGGGAAGTACCCTTAGGCAGAAGGGACTCTCGAGATGCAAGCATAAGTGGCTCCAACAACAACATTCCAGCCCCAAATAGCATATTTCCGACCCTCCAAACAAAAT
TCGAGCAACAGGGGCTTAACCTTACTGATCTAGTTACTCTATCGG
GTATTCTCCTAAAATTTGTCTGTTTCAAATTCTTTTTAGATAAATTTTTCTAAAAATACATATAAAAGAAAAAGA
ATGAGAAACAAATAAAAGAAAAAGTTCTCCCTAAGTTATAATTAACTCATGCAAAATCTAACTTCTAGAAGTTTTTTTTGTTTATTTATCCAAAAGTTGATTTTTAACCTTTAACATAAG
CTAAAAAAAAAATTATCTCAAATTTTGTATTTTCTTTTTCTATAGGTGTTTCGTGAAAAGTTTACTCTAGTATGCCTCCTAGTTTTAGTGTTCAGATTGGTTTGTGGTGAATTTTGATTA
GCATAATCCAATTACATACTAATATTATCCTCATGTTGCATGTCATGCATAAACTTGAGTCAAAATTATTTCAATGTCATTTTCTAAACAATTTTGGTACAAATGTTACATATAGGGGCC
CATACTCTAGGAGTCGCCAGGTGCACCAACTTCAGGCAAAGACTCTACAACCAAAGTGGAAATGGCCAGCCAGATCCCACTCTTGACCAAAACTATGCTGCTTTTTTGCGTGTTACGTGT
CCAAGGACGACTTTGGGTGACCAGAATCCGTTCTTCCTAGACTACGCCACACCACTTAAATTTGACAACAGCTACTTCAAGAACCTGATGGAAAACAAGGGTCTCTTAAATTCTGATCAA
ATTCTCTTCACAATGAACCAAGAATCAGCTGAGTTAGTGAGGTTGTATGCTGAAAGAAACGACCTTTTCTTTGAACAATTCTCCAAGTCCATGATCAAGATGGGAAACATTTCTCCTTTG
ACGAATTCAAGTGGAGAGATCAGACAGAACTGCCGGAGGGTTAACGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCAATTCCATGAGCTTTCTCCTGCTTCTTTCTTTACTAGCCTTTGCTCCCTTGTGCCTCTGTAACCTCAACCCTCAGTTTTATGACAATTCATGCCCTCAAGCTCAGCAAATTGCC
AAGTCCATTCTTACCTCGTATTTTGTAATTCAACCCGGATATGCGGCTCAAATTCTCAGGCTTCATTTCCATGATTGTTTTGTCATG
GGATGTGATGGTTCATTGTTGTTAGATAGCAGT
GAAAGCATCGTCAGTGAGAAGGAATCAGATCCCAACCGTGATTCAGCTAGAGGATTTATAGTCATTGATGCAATTAAACTGGCGATAGAGAGAGCATGCCCTTCTACAGTGTCTTGTGCT
GACATCTTGACTATAGCTGCAAGAGATTCAGTTGTTCTT
ACTGGTGGACCAAGCTGGGAAGTACCCTTAGGCAGAAGGGACTCTCGAGATGCAAGCATAAGTGGCTCCAACAACAACATT
CCAGCCCCAAATAGCATATTTCCGACCCTCCAAACAAAATTCGAGCAACAGGGGCTTAACCTTACTGATCTAGTTACTCTATCGG
GGGCCCATACTCTAGGAGTCGCCAGGTGCACCAAC
TTCAGGCAAAGACTCTACAACCAAAGTGGAAATGGCCAGCCAGATCCCACTCTTGACCAAAACTATGCTGCTTTTTTGCGTGTTACGTGTCCAAGGACGACTTTGGGTGACCAGAATCCG
TTCTTCCTAGACTACGCCACACCACTTAAATTTGACAACAGCTACTTCAAGAACCTGATGGAAAACAAGGGTCTCTTAAATTCTGATCAAATTCTCTTCACAATGAACCAAGAATCAGCT
GAGTTAGTGAGGTTGTATGCTGAAAGAAACGACCTTTTCTTTGAACAATTCTCCAAGTCCATGATCAAGATGGGAAACATTTCTCCTTTGACGAATTCAAGTGGAGAGATCAGACAGAAC
TGCCGGAGGGTTAACGCTTGA

Retrieve as FASTA