1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx276 (Glyma16g27890.1)
Entry ID 9011
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-04 (Christophe Dunand)
Peroxidase information: GmPrx276 (Glyma16g27890.1)
Name (synonym) GmPrx276 (Glyma16g27890.1)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx276
start..stop		 S start..stop
GmPrx329 495 1.32e-177 11..345 9..342
LjPrx11 478 1.01e-170 7..344 8..347
MtPrx48 460 9.2e-164 7..345 10..349
GmPrx32 419 9.81e-148 8..344 14..348
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx276 (Glyma16g27890.1)
DNA ref. Phytozome 12:   Gm16 (31838998..31836098)
Protein sequence: GmPrx276 (Glyma16g27890.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   346 (316)
PWM (Da):   %s   38782.62 (35259.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   6.92 (7.18) Peptide Signal:   %s   cut: 31 range:31-346
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPPNSFCSLFFIYSILLSSFFLAYEAQAYPPVVNGLSYSFYSQTCPKLESIVRNHLEKEFTQASWQAAALLVVFFHDCFVQGCDGSLLLDGNPGERDHPLNRGISLKVLRTIDDLRNV
VHNECGRIVSCADITVLAARDAVYLSGGPNFAVPLGRRDSLNFSFEEVNNLPLPYNITSVTLQTFASKNLDVTNVVALVGAHTLGRAHCHTFYNRLSPLDPNMDKTLAKILNTTCPSTYS
RNTANLDIRTPKVFDNKYYINLMNRQGLFTSDQDLFTDKRTKGLVEAFAHDQTLFFEKFVDGFIRMSQLDVLTGNQGEIRAKCNVINNKRPIVTSINVDEMVQLIY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA ►
Send to BLAST
CDS►
Send to BLAST