1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx288 (Glyma17g06090.1)
Entry ID 9015
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx288 (Glyma17g06090.1)
Name (synonym) GmPrx288 (Glyma17g06090.1)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx288
start..stop		 S start..stop
GmPrx235 615 0 1..333 1..331
GmPrx76 607 0 1..332 1..330
LjPrx26 556 0 12..332 13..333
MtPrx09 540 0 10..332 9..330
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx288 (Glyma17g06090.1)
DNA ref. Phytozome 12:   Gm17 (4306105..4308425)
Protein sequence: GmPrx288 (Glyma17g06090.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (307)
PWM (Da):   %s   35814.51 (32800.1) Transmb domain:   %s   i7-26o
PI (pH):   %s   4.88 (4.69) Peptide Signal:   %s   cut: 26 range:26-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRSCSSSGCYFWLMNMNMFLLLLAVKSELTTDFYKSSCPNVSKIVRREVKKALTNEMRMAASLLRLHFHDCFVNGCDGSILLDGGDDGEKSAVPNLNSARGYDVVDTIKSSVESECDGV
VSCADILAIAARDSVFLSGGPSWKVLLGRRDGTVSNGTLANEALPAPFDPLDTIISKFANMGLNLTDVVSLSGAHTIGRARCTLFSNRLSNFSGTGAPDTTLDTDMLSDLQSLCPQNGDG
NVTTVLDRNSSDLFDNHYFENLLSGKGLLSSDQILFSSDEANSTTKPLVQSYSNDSGLFFGDFSNSMIKMGNINIKTGTDGEIRKNCRVINS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST