Entry information : GmPrx290 (Glyma17g17730.1)
Entry ID 9016
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx290 (Glyma17g17730.1)
Name (synonym) GmPrx290 (Glyma17g17730.1)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx290
start..stop
S start..stop
GmPrx23 646 0 1..325 1..325
MtPrx38 572 0 1..325 1..323
MsPrx12 570 0 1..325 1..323
TrPrx02 563 0 1..325 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14768775..14768993 219 N° 2 14768057..14768257 201 N° 3 14767477..14767642 166 N° 4 14765714..14766105 392
complement(join(14765714..14766105,14767477..14767642,14768057..14768257,1476877 5..14768993))


exon

Literature and cross-references GmPrx290 (Glyma17g17730.1)
DNA ref. Phytozome 12:   Gm17 (14768993..14765714)
Protein sequence: GmPrx290 (Glyma17g17730.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (299)
PWM (Da):   %s   35249.95 (32295.3)  
PI (pH):   %s   9.25 (9.11) Peptide Signal:   %s   cut: 27 range:27-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRLNLLLVWSLSLTLSLYYLHPISAQLSPNHYAKTCPNLESIVRQAVTKKFQQTFVTVPATLRLFFHDCFVxGCDASVLIASTGNNQAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPQCRNKVSCADILALATRDVIALSGGPSYTVELGRFDGLVSRTSDVNGRLPQPTNNLNQLNSLFAANGLTQTDMIALSGAHTLGFSHCSKFASRIYSTPVDPTLNKQYVAQLQQMCPRNVDPRIAINMDPTTPRKFDNVYYQNLQQGKGLFTSDQILFTDPRSRNTVNSFASSSNVFNSNFVAAMTKLGRVGVKTARNGKIRTDCSVL

Retrieve as FASTA  
Remarks Complete sequence from genomic and 55 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGCTTAATCTCCTACTTGTGTGGTCACTCTCATTAACACTGTCCCTTTATTATCTACACCCAATCTCTGCTCAGCTCAGTCCAAACCACTATGCTAAAACATGCCCCAATCTT
GAAAGCATCGTTAGACAGGCCGTTACCAAGAAGTTCCAACAAACCTTTGTCACCGTCCCAGCCACCCTTCGTCTCTTCTTTCATGATTGCTTTGTGNNN
NNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAACTCAATTGCATACCCA
CATAATGCCAATTGTTGCAATCACGCTCGCAGTTTCATCGGGATCCTTGACATTGCACAAGACTGTGCTAGCTGCAATTGTTTTCCTAAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTTTTTATAGTATTGCAGTCA
TGATTGGTGGCAAAAAGTATAAAAATCCAGACATTGCGACTGAAATTGCAGTCGCAAACAGTTTTTAAAAGCCTTGTTGATTATTTCTTGTTGAACTGATCAGTGTTCTAATTTTTTTGT
GTGTGCTGTGTTAAAGGGTTGTGATGCTTCTGTTTTGATTGCATCCACCGGAAACAACCAAGCAGAGAAGGATCACCCAGACAACCTGTCTTTGGCGGGTGATGGGTTTGACACAGTGAT
CAAAGCAAAGGCTGCAGTAGATGCCATCCCTCAGTGCAGAAACAAAGTCTCATGTGCTGATATTCTGGCCTTGGCCACCCGTGATGTTATTGCACTG
GTTAGTTCTTCAATAACACTCCA
ATTCGCGTGAGAAAAAAAAAACATAGTTTAATTTTTGGGATTAGGAATTAATTTTAGGTAAATGGTGAATTTGGTGCTTAAAAGTGTAACACCAAAAGTTAATAAATATTCTTAAAATAT
TGATTATAAAATTAAAAGAAAAAATATTTTTATCAGGATACCTAAAATACATTAACATGAATTTTTTATGTTCTCTTATAATTTTTATTTAATCACTTAGCACGTAGGAAGTACAACAAT
CAAAATTATATGATTGTGACATTTTTCACACATTTGAAAAGTAAATTGTTACTGCTTCACATCTTCAGAAAGTGGGCATTTATCCAAGTTAATTTCTTTGAAGATTGGTTAAAAAATGAA
CTAACAAACGCATGTGGGGGTATGTGTGTAGTCTGGTGGACCTTCATACACGGTTGAATTGGGAAGATTTGATGGTTTAGTTTCAAGAACTTCGGATGTGAATGGGAGGCTTCCACAGCC
AACGAACAATTTGAACCAATTGAATTCACTGTTTGCGGCAAACGGCCTCACCCAAACTGACATGATTGCTCTCTCAG
GTAATCTCCGTGCAACTGTTTGCAAATGGGTCCCATTTGCGTT
TGTGCACGTTCTTGGGTCCTTGTTAGAGTGGTTGATATTTGATAATGTATCTTCTCATTTATGTTATTGCAAAGTATAGTCAAATGAGGAGATAATGATTCACGAGCGAAATAGTACACG
CTAATTAAGGCCGTTTGGTTAATTAATTAGGCTTAATAAAAGAAGAGGTGGTTGGGGGAGAGACACTACTAGAAATTAGACTCCTTTAATCTATGGCTGTTAATACTTAATTTTATCAAT
TTTTTCATAAATTAAAAGCTTTAATTGTTTTTTTTTTTTGAAAAAAAACAGTAAACTATAAATATGTAGTGATGCCATTTCATATAATAATTTCTAAGGAGAGGGGCACAATACACATTT
AAGTTGTTTGGTTGATAGAGAAAATTTATTAGGTGGTTTAGATAATCTTGTGTTTGTAGTCTTAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATCATAATAGTCGTTTGCTGTCTAATAATTTCTCAAAATTTAAATCAGTTTCCTTAACAACGGTTTTTAATTGTGATCTAATTTTCATTA
TATCCTTGACGTAATAATTAAATAATATGTTTCCTAAACGTCAATTCTTAAATGTATTTAAATATGTAGAAGTTAAAATCCTTAAATAATTACAGTTTTAAATAAACATTCAGTTGTTAT
CATTTAATTAAAAAAACTTGATGGCATAAATGTGAAGACCTTGTTCTAAATTTTATCTTTAAAAGTGAAATTTATAACAGTCGTTTTTTAAAATCTAAAATTGTTATTTTATTTTGAAAT
ATTTGAAACATGATTTTCATTATTTTGTTCTATAAATGTTCAAACAACGATAAAATAATGTAGTAGTAGTAAGAGATTCGTGTATTAAATATAATAAAACACAGTCATTTGTGAATCAGA
AGCCACTGAATCAAACAACATAGAAAACCGAGCTTAACGCTTGTGAGCTTGCATTCAAGTTGCACAGCCAAAACAGCAGCCAGAAAACGAAGCCTCGCGTTCAGATCTCAAATCCTTATC
AAAAGTGATTATCTAAATGCTAACAAGTGTTTTTAAACATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTTTAGGACACTGTTTAACAAAATACTACACTTATTTCCTCCATCCATCAACGTGCCTAATTGTCCCTTTTTTTTTTT
TGTTGCAGGTGCGCACACCCTTGGATTCTCCCACTGCAGCAAGTTCGCCAGTAGAATATACAGTACCCCAGTGGACCCAACACTGAACAAGCAATACGTAGCCCAATTGCAACAAATGTG
CCCAAGGAACGTGGATCCTAGGATTGCCATCAACATGGACCCAACCACTCCTCGTAAATTCGACAACGTTTATTACCAAAACCTTCAACAAGGAAAGGGCCTCTTTACCTCGGACCAAAT
CCTCTTCACGGACCCAAGGTCCAGAAACACAGTTAATTCCTTCGCTTCTAGTAGCAACGTTTTCAACTCCAACTTTGTGGCTGCTATGACCAAATTGGGTCGTGTTGGAGTTAAGACTGC
GAGAAATGGGAAAATTCGTACCGATTGTTCTGTTCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGGCTTAATCTCCTACTTGTGTGGTCACTCTCATTAACACTGTCCCTTTATTATCTACACCCAATCTCTGCTCAGCTCAGTCCAAACCACTATGCTAAAACATGCCCCAATCTT
GAAAGCATCGTTAGACAGGCCGTTACCAAGAAGTTCCAACAAACCTTTGTCACCGTCCCAGCCACCCTTCGTCTCTTCTTTCATGATTGCTTTGTGNNN
GGTTGTGATGCTTCTGTTTTG
ATTGCATCCACCGGAAACAACCAAGCAGAGAAGGATCACCCAGACAACCTGTCTTTGGCGGGTGATGGGTTTGACACAGTGATCAAAGCAAAGGCTGCAGTAGATGCCATCCCTCAGTGC
AGAAACAAAGTCTCATGTGCTGATATTCTGGCCTTGGCCACCCGTGATGTTATTGCACTG
TCTGGTGGACCTTCATACACGGTTGAATTGGGAAGATTTGATGGTTTAGTTTCAAGAACT
TCGGATGTGAATGGGAGGCTTCCACAGCCAACGAACAATTTGAACCAATTGAATTCACTGTTTGCGGCAAACGGCCTCACCCAAACTGACATGATTGCTCTCTCAG
GTGCGCACACCCTT
GGATTCTCCCACTGCAGCAAGTTCGCCAGTAGAATATACAGTACCCCAGTGGACCCAACACTGAACAAGCAATACGTAGCCCAATTGCAACAAATGTGCCCAAGGAACGTGGATCCTAGG
ATTGCCATCAACATGGACCCAACCACTCCTCGTAAATTCGACAACGTTTATTACCAAAACCTTCAACAAGGAAAGGGCCTCTTTACCTCGGACCAAATCCTCTTCACGGACCCAAGGTCC
AGAAACACAGTTAATTCCTTCGCTTCTAGTAGCAACGTTTTCAACTCCAACTTTGTGGCTGCTATGACCAAATTGGGTCGTGTTGGAGTTAAGACTGCGAGAAATGGGAAAATTCGTACC
GATTGTTCTGTTCTTTAA

Retrieve as FASTA