Entry information : GmPrx295 (Glyma17g33730.1)
Entry ID 9018
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-04 (Christophe Dunand)
Peroxidase information: GmPrx295 (Glyma17g33730.1)
Name (synonym) GmPrx295 (Glyma17g33730.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx295
start..stop
S start..stop
GmPrx67 626 0 1..330 1..329
GmPrx151 514 0 12..330 8..326
PtPrx52 488 1e-175 9..326 5..330
MtPrx114 486 1e-174 1..329 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37691666..37691896 231 N° 2 37690711..37690890 180 N° 3 37690446..37690611 166 N° 4 37689276..37689691 416
complement(join(37689276..37689691,37690446..37690611,37690711..37690890,3769166 6..37691896))


exon

Literature and cross-references GmPrx295 (Glyma17g33730.1)
DNA ref. Phytozome 12:   Gm17 (37691896..37689276)
Protein sequence: GmPrx295 (Glyma17g33730.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331
PWM (Da):   %s   35781.71 Transmb domain:   %s   i7-29o
PI (pH):   %s   4.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKGAMVFPFPIAVSCLFIIVHIFANSVSGSLVFNFYAASCPTAELIVRNTVSSSSSSDPSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKSDPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIEIPTGRRDGMVSVASNVRPNILDTSFTMDEMINRFSSKGLSLFDLVILSGAHTIGAAHCSSFRDRFQEDSKGKLTLIDKTLDNTYADELMKECPLSASPSVTVNNDPETSMVFDNQYYRNLLTNKGLFQSDSALLSDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGVKTGDEGEIRSSCASINA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAGGAGCAATGGTTTTTCCTTTTCCAATAGCAGTTTCTTGTCTTTTTATTATCGTCCATATTTTTGCTAATTCTGTTTCAGGTAGCCTAGTTTTCAACTTCTATGCAGCTTCA
TGCCCCACAGCAGAACTCATTGTGAGAAACACAGTCAGTTCATCTTCTTCTTCTGATCCTTCAATTCCTGGGAAGCTACTTCGCTTGGTTTTCCATGATTGCTTTGTGGAG
GTTAGTGTA
TACTATTAGTCCTACACATGTTCTCGCACACATATAGGAATCGAAGACATATACCAGCAGGTTTACAGACACCTTACTCAATCAAGACACTTATATATGTTCACATTATATATATGTTCA
CATATATATATGCTCACATTATATTTGTATTAGGATATTTATCTTTCATATTTTCGGTCTTTTCCTCTTGTGCTTGGACTTAATTCCTTTAAGGTAAGTAATCTTAGTCGTTGATAAGAA
AATCAGTGATTGATATAATAATAAGACATGCATGATTTGTTATGCATGTGCACTGTGCACATACATCAACTATTAATTTTCTTATTAATGAATAAAATTATTTATTTTACTCAATAAAAT
AGGTAATTAACTCACTTTAGAAGAGTCAGATAGATCCCATTTGTACTTGGACTTGGGTCCTCTAAAATAAGGGTAAAGTGAGTAATCTGATTAGTTAATGAAAAACTCAATGATTGATTT
ATTAACACATTTATGATCTGTCATGCGTGTGTACCTAACATCAAGGGTTGATTTTCTTATCAACGGCTAAAATTAATCTCTTCATTCTCAAAGTGAGTTCCTCACTTTAGAGGAGTCAGA
TCACTTGCTTGCACTTAAGGCTTTCCCTAAATGGGCTAGCCGGTTCTGTGGGGTTCAATTAGGCCCTAAGTTCAAATTCTACAAGAATCTTACTGGGAATGTGGTATCTTATGTTCTTGT
GCTTCATTTGTGTGATGGTGATCAATGATCAGTTCATGATATGTAGGGATGTGATGCCTCTTTGATGCTACTAGGGAATAATACTGAAAAAAGTGATCCAGCAAATAGGTCTGTTGGAGG
ATTTTCGGTTATAGAATCAGCAAAAAGAGTCCTTGAGTTCCTTTGTCCTGGAACAGTTTCTTGTGCTGACATAATTGCTTTGGCTGCTAGAGATGCTGTTGAAATT
GTAAGTTATCCACT
TATCCTCATTACATTGCTGATATTCTTCCAAAATGCAATGACATCAAGTTTGGTATGGTAATTTTCTGAGGGTATTTGAAAACAGGTCGGTGGTCCTATGATTGAAATTCCCACAGGGAG
AAGAGATGGAATGGTTTCAGTTGCTTCAAATGTCAGACCCAACATTTTGGACACCAGTTTTACAATGGATGAGATGATTAACCGTTTCTCTAGTAAAGGGTTGTCCTTATTTGACCTTGT
CATCCTTTCAG
GTGCATATTCTTCCAAGTATATATTTTCAGGTTCCTATAACTATTGACATGCTTCTCTTTAATAAGTATCATTCCTTTGGTTTTCAGTCTCTTCCCCTGCCCTTTATTC
TTAGAGGGGTAATTGACCATGAGTTTCATCATGCTTGAGGTAAAAAACCATAAAGGCATAAGGCTAGACAATACATTCTGTTAGGTAGAAAGAATTGAATTATTGATGTTTTGTAGATGA
GAACGTACTCCCTACATTTATTATAATTATTGTTCTGCAGATGGTGGCTTGCTTTTCTACGTAGTTTTTTTAATATTAAAAAACTGAATATGTTTTGGTATAAAGGTATCATATTATAAA
AGATTCCATGCATTTTTAGTGTTAACTTTTAATCAATTAAAATCACTTTAGATATAATTTTTGAAGTAACTATAATAAAAATTAACAATTTTATGATATATGACATTTTATGATTAGGAG
ACTGTGTCAGTGTATTCATATTAAATTTATAAAAGATTGTAAATCAGTACGAGTGTGTTTGGATTTCTGGTAGGGGGTAGAGGTTCCAAAAGTACGTTTAAAAATAAAATCAGGTTAAGA
TCACATTTGATTACCCCTCAAAAGTATGTTTTAAGTTAAAATTTTGGCCTGGAAACTTAGTTTGAGGGAAGTAAAACTTGGGATACTTTTGCAAACTTTATTCCAAACATAGGATTAAAC
TTTTATTCACACAGTATGCTACATAGTGATGCTTTGGCTTTGTAGGGGCTCACACCATAGGAGCAGCTCATTGCAGCTCATTCAGGGATAGGTTCCAAGAAGACTCAAAGGGAAAGCTCA
CACTCATTGACAAAACCCTTGACAATACCTATGCAGACGAGCTAATGAAAGAGTGTCCCTTAAGTGCAAGCCCTTCTGTTACAGTTAACAATGATCCTGAAACATCCATGGTCTTTGACA
ACCAGTACTACAGAAATCTTCTCACCAACAAAGGGTTGTTCCAATCTGATTCTGCTCTGCTAAGTGACAATAGAACAAGGAAATTTGTGGAGGACTTGGCAAATGATCAAGAGTTTTTCT
TTGAAAGTTGGGGCCAGTCTTTCTTAAAGCTCACTAGTATTGGAGTCAAAACTGGTGATGAGGGTGAAATTAGAAGTTCTTGTGCATCAATTAATGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAGGAGCAATGGTTTTTCCTTTTCCAATAGCAGTTTCTTGTCTTTTTATTATCGTCCATATTTTTGCTAATTCTGTTTCAGGTAGCCTAGTTTTCAACTTCTATGCAGCTTCA
TGCCCCACAGCAGAACTCATTGTGAGAAACACAGTCAGTTCATCTTCTTCTTCTGATCCTTCAATTCCTGGGAAGCTACTTCGCTTGGTTTTCCATGATTGCTTTGTGGAG
GGATGTGAT
GCCTCTTTGATGCTACTAGGGAATAATACTGAAAAAAGTGATCCAGCAAATAGGTCTGTTGGAGGATTTTCGGTTATAGAATCAGCAAAAAGAGTCCTTGAGTTCCTTTGTCCTGGAACA
GTTTCTTGTGCTGACATAATTGCTTTGGCTGCTAGAGATGCTGTTGAAATT
GTCGGTGGTCCTATGATTGAAATTCCCACAGGGAGAAGAGATGGAATGGTTTCAGTTGCTTCAAATGTC
AGACCCAACATTTTGGACACCAGTTTTACAATGGATGAGATGATTAACCGTTTCTCTAGTAAAGGGTTGTCCTTATTTGACCTTGTCATCCTTTCAG
GGGCTCACACCATAGGAGCAGCT
CATTGCAGCTCATTCAGGGATAGGTTCCAAGAAGACTCAAAGGGAAAGCTCACACTCATTGACAAAACCCTTGACAATACCTATGCAGACGAGCTAATGAAAGAGTGTCCCTTAAGTGCA
AGCCCTTCTGTTACAGTTAACAATGATCCTGAAACATCCATGGTCTTTGACAACCAGTACTACAGAAATCTTCTCACCAACAAAGGGTTGTTCCAATCTGATTCTGCTCTGCTAAGTGAC
AATAGAACAAGGAAATTTGTGGAGGACTTGGCAAATGATCAAGAGTTTTTCTTTGAAAGTTGGGGCCAGTCTTTCTTAAAGCTCACTAGTATTGGAGTCAAAACTGGTGATGAGGGTGAA
ATTAGAAGTTCTTGTGCATCAATTAATGCATAA

Retrieve as FASTA