Entry information : GmPrx312 (Glyma20g00330.1)
Entry ID 9025
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-09 (Christophe Dunand)
Peroxidase information: GmPrx312 (Glyma20g00330.1)
Name (synonym) GmPrx312 (Glyma20g00330.1)
Class Class III peroxidase    [Orthogroup: Prx187]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx312
start..stop
S start..stop
GmPrx190 566 0 1..329 1..329
GmPrx195 549 0 1..329 1..328
GmPrx189 549 0 1..329 1..328
MtPrx50 473 1e-169 29..329 30..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150660..150878 219 N° 2 151146..151916 771  
join(150660..150878,151146..151916)


exon

Literature and cross-references GmPrx312 (Glyma20g00330.1)
DNA ref. Phytozome 12:   Gm20 (150660..151916)
Protein sequence: GmPrx312 (Glyma20g00330.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (303)
PWM (Da):   %s   35015.33 (32190.8)  
PI (pH):   %s   4.79 (4.78) Peptide Signal:   %s   cut: 27 range:27-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDNTPRLIQTVSSLVLILSISSLASASLKVGFYSSTCPSAEAIVKSTVEKAISANPGIAAGLIRMHFHDCFVRGCDGSVLLASTPGNPISERDNFVNNPSLRGFEVIEDAKNQIEAACPETVSCADILAFAARDSVSKVGGISYDVPSGRRDGRVSIGDEVLDNLPRPSLSADDLISNFERKGLSADEMVTLSGAHSIGVSHCGAFSNRLYSFSDTVTQDPSLDSSYAETLKTQCPPPPPTSDPTVSLEPSTPIRLDSKYYEGLINHRGLLTSDQTLYTSQSTRGMVQSNANNGASWADKFALAMLRMGSIEVLTGSDGEIRKQCSFVN*

Retrieve as FASTA  
Remarks Comolete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATACTCCAAGATTGATTCAAACGGTTTCAAGCTTGGTTCTGATTCTAAGCATTTCATCATTGGCCTCGGCATCTCTGAAAGTGGGTTTCTACAGCTCAACGTGTCCCTCTGCC
GAGGCAATAGTTAAAAGCACGGTAGAAAAAGCAATATCTGCCAACCCAGGCATAGCTGCTGGTCTCATCAGAATGCATTTCCATGATTGCTTTGTCAGG
GTAAGTTAGCAAGGGTATGTT
TAGATAAACTTTTCCAGAAACACTTTTTAAAAAAAAAAATTAAAATGAGTTTCTTTATAAGCTAAAAAATGCATAAGCTAATTCGTAGAACCTTTCTTATACTGAAAAACTCATTTCGAC
TTGTTCTTCTTAAAAGTACTTCTGGACGAGCTTCTCCAAACAGATCGACCTTCAAAGTTTCCTATATAAATGCATGTTTAATAAAAAGATTTGAATTTCTGGTTCTAAAATTGTTATGTC
TTACAGGGTTGCGATGGTTCTGTGCTACTGGCATCTACACCGGGTAATCCAATATCTGAAAGAGACAATTTCGTGAACAACCCAAGCTTGCGCGGCTTCGAGGTGATTGAGGATGCCAAG
AACCAAATAGAGGCTGCATGCCCTGAAACGGTATCATGTGCAGACATATTGGCATTCGCAGCACGAGACAGTGTTTCCAAAGTGGGTGGCATAAGCTACGACGTTCCATCGGGACGAAGA
GATGGGCGTGTCTCGATCGGCGATGAAGTGCTAGACAATCTTCCTAGACCATCCTTGAGCGCTGATGATCTTATTAGTAACTTTGAGCGAAAGGGTTTGTCAGCAGATGAAATGGTGACA
CTCTCAGGAGCGCATTCAATCGGTGTGTCCCATTGTGGTGCCTTCTCGAATCGCTTATACTCTTTCAGTGACACAGTCACACAAGATCCCTCATTGGACTCTTCATATGCTGAAACGTTG
AAAACACAGTGTCCCCCACCACCACCCACCTCAGACCCAACAGTGTCTCTTGAACCATCCACGCCAATTCGTTTGGACAGTAAATACTATGAGGGATTGATCAACCACCGCGGCTTGTTG
ACTTCGGATCAGACATTGTACACGAGCCAATCCACAAGGGGAATGGTTCAAAGCAATGCTAACAATGGTGCCAGTTGGGCTGACAAGTTTGCCCTAGCAATGCTTCGCATGGGTTCTATA
GAAGTGCTTACTGGCTCCGATGGTGAGATCAGGAAGCAGTGCAGCTTTGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATAATACTCCAAGATTGATTCAAACGGTTTCAAGCTTGGTTCTGATTCTAAGCATTTCATCATTGGCCTCGGCATCTCTGAAAGTGGGTTTCTACAGCTCAACGTGTCCCTCTGCC
GAGGCAATAGTTAAAAGCACGGTAGAAAAAGCAATATCTGCCAACCCAGGCATAGCTGCTGGTCTCATCAGAATGCATTTCCATGATTGCTTTGTCAGG
GGTTGCGATGGTTCTGTGCTA
CTGGCATCTACACCGGGTAATCCAATATCTGAAAGAGACAATTTCGTGAACAACCCAAGCTTGCGCGGCTTCGAGGTGATTGAGGATGCCAAGAACCAAATAGAGGCTGCATGCCCTGAA
ACGGTATCATGTGCAGACATATTGGCATTCGCAGCACGAGACAGTGTTTCCAAAGTGGGTGGCATAAGCTACGACGTTCCATCGGGACGAAGAGATGGGCGTGTCTCGATCGGCGATGAA
GTGCTAGACAATCTTCCTAGACCATCCTTGAGCGCTGATGATCTTATTAGTAACTTTGAGCGAAAGGGTTTGTCAGCAGATGAAATGGTGACACTCTCAGGAGCGCATTCAATCGGTGTG
TCCCATTGTGGTGCCTTCTCGAATCGCTTATACTCTTTCAGTGACACAGTCACACAAGATCCCTCATTGGACTCTTCATATGCTGAAACGTTGAAAACACAGTGTCCCCCACCACCACCC
ACCTCAGACCCAACAGTGTCTCTTGAACCATCCACGCCAATTCGTTTGGACAGTAAATACTATGAGGGATTGATCAACCACCGCGGCTTGTTGACTTCGGATCAGACATTGTACACGAGC
CAATCCACAAGGGGAATGGTTCAAAGCAATGCTAACAATGGTGCCAGTTGGGCTGACAAGTTTGCCCTAGCAATGCTTCGCATGGGTTCTATAGAAGTGCTTACTGGCTCCGATGGTGAG
ATCAGGAAGCAGTGCAGCTTTGTTAATTAA

Retrieve as FASTA