1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx314 (Glyma20g30910.1)
Entry ID 9026
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx314 (Glyma20g30910.1)
Name (synonym) GmPrx314 (Glyma20g30910.1)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx314
start..stop		 S start..stop
GmPrx20 702 0 1..357 1..357
VaPrx01 634 0 1..356 1..357
PvPrx15 619 0 5..357 3..355
LjPrx02 568 0 8..356 4..352
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx314 (Glyma20g30910.1)
DNA ref. Phytozome 12:   Gm20 (39574196..39576314)
Protein sequence: GmPrx314 (Glyma20g30910.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356 (326)
PWM (Da):   %s   38890.82 (35511.2)  
PI (pH):   %s   7.26 (8.20) Peptide Signal:   %s   cut: 31 range:31-356
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASISCMSAILSFLLISIFLSVYNIEVCEAQARPPTAKGLSYTFYDKSCPKLKSIVRSELKKVFNKDIAQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPGEKEAPPNLTLRPEAFKIIE
NLRGLLEKSCGRVVSCSDITALTARDAVFLSGGPDYEIPLGRRDGLTFATRQVTLDNLPPPSSNASTILSSLATKNLDPTDVVALSGGHTIGISHCSSFTNRLYPTQDPVMDKTFGNNLR
RTCPAANTDNTTVLDIRSPNTFDNKYYVDLLNRQGLFTSDQDLYTDKRTKGIVSDFAVNQNLFFEKFVFAMLKMGQLNVLTGKQGEIRANCSVRNANNKSLLTSVVEDVVETLIEM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA ►
Send to BLAST
CDS►
Send to BLAST