Entry information : GmPrx93 (Glyma01g03310.1)
Entry ID 9028
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx93 (Glyma01g03310.1)
Name (synonym) GmPrx93 (Glyma01g03310.1)
Class Class III peroxidase    [Orthogroup: Prx185]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx93
start..stop
S start..stop
GmPrx107 644 0 1..380 1..380
LjPrx43 451 4e-159 1..380 1..390
MtPrx83 446 3e-157 1..380 1..377
PpePrx40 253 5e-82 80..380 36..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2822006..2822368 363 N° 2 2820584..2821363 780  
complement(join(2820584..2821363,2822006..2822368))


exon

Literature and cross-references GmPrx93 (Glyma01g03310.1)
DNA ref. Phytozome 12:   Gm01 (2822368..2820584)
Protein sequence: GmPrx93 (Glyma01g03310.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (357)
PWM (Da):   %s   42295.52 (39567.0)  
PI (pH):   %s   5.72 (5.12) Peptide Signal:   %s   cut: 24 range:24-380
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMTRIFLTTLSLWLLVLAPSKAEEGFPDKLPSTFHSLFPFLGRQDDLNKPQKGPNDESQQQNVPQQAADQNPQILSQDFYIKTCPNAQKIVADALAKIVKTNPGALGNLLRLQFHDCFVNGCDASILLDYSPSGDAVEKSSMVNGLLLKGADMIDEIKLKLEEQCPQTVSCADTLAFTANEVMTMAGLAPQKPLGGRRDALVSLATAAETDNIPMPNWTMEQMVKLFNKKGFNIEEMVILLGAHSIGMAHCDLFIERAYNFQNTGKPDPSLTVEVLEELRKACPNLNTPKYRNPPVNFDATPTVLDNLFYKDMVERKRTLLITDSHILEDPRTLPIVQQFAHDASLFPRRFPEVMLKMSSLNVLTGNEGEVRKICRSTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGACACGGATCTTCCTTACGACCCTTTCATTGTGGCTCTTGGTCCTCGCTCCTTCCAAGGCCGAGGAGGGATTTCCCGACAAACTTCCATCAACATTTCATTCTCTATTTCCG
TTTCTCGGTCGTCAAGATGACCTGAACAAGCCACAAAAGGGTCCTAATGACGAGTCTCAACAACAGAACGTGCCTCAACAAGCGGCTGACCAAAATCCTCAGATACTCAGCCAAGATTTC
TACATTAAGACTTGCCCTAATGCACAAAAAATCGTGGCCGATGCACTTGCCAAGATTGTTAAGACCAATCCGGGCGCACTCGGAAACTTACTCCGCCTTCAATTCCATGACTGCTTCGTT
AAT
GTAAGTTTTCCCTAACAATTGCACACCATATAGTCTTTCTTCTCCATAATTAAACCATATCATTACCAAAGTTTATAATAGCAATACGTATAACTATAGCCCAATANNNNNNNNNNN
NNNNNNNNNACACACTCACACGTTACAACATCAATTTGGTTCAAATATTACAAAACAAAAAAAAGCAGTTAGCCGTCATTAATCAATATGGTCATGAATTTGACATTATAGCTCAATTTA
ATTAATCTCTGGTTAGTGTGTTAATTCGCTCTTTAAATTGACAAAAGAACTAAATTTTAATCAATACTTGTTGTTTCAACATAATATTGGGGATTTGTTATGCATGTATATACATAATAT
TAATCATAATTTTTTTCATCGATCAATGACTGAGATTACTTGTCTCATCCTCTAAAGTACATTGTTCACCTTATTCGAGTGGGATCCTTTTGATCAACAACTAAAGTGACTAGTAATATT
AATTTAAGGAATCAAATTGACATGTGGTTCCAATTTCATAACCAAATTGATGTTTTGCTAGTATTTATATTGGGAGTGTTTGACTGATGAGAGATAGTTATATGAAATGACATTGTGATG
ATGAGTTTCTAAACCGAACTTGGTCATGTGGAATCAAATAAACAGGGATGCGATGCATCCATCTTGCTAGATTACTCGCCAAGTGGCGACGCTGTGGAGAAAAGTTCAATGGTCAATGGT
CTACTCCTCAAAGGAGCTGATATGATCGATGAAATAAAGTTGAAGCTGGAGGAGCAGTGTCCTCAAACCGTGTCATGCGCTGACACATTGGCATTTACAGCCAACGAGGTAATGACCATG
GCGGGTTTGGCCCCTCAGAAACCCCTCGGTGGCCGTAGAGACGCGCTCGTTTCCCTTGCAACCGCTGCAGAAACCGACAACATCCCTATGCCAAACTGGACCATGGAACAAATGGTAAAA
CTCTTCAACAAGAAGGGTTTCAACATCGAAGAAATGGTGATCCTACTCGGTGCACACTCGATCGGCATGGCTCATTGCGACTTGTTCATTGAAAGGGCATACAACTTCCAAAACACAGGG
AAACCAGACCCTTCCCTTACTGTGGAAGTGCTTGAGGAATTAAGAAAGGCATGCCCTAATCTTAATACACCTAAGTACCGGAACCCCCCAGTGAACTTTGATGCAACACCAACTGTGCTT
GATAACCTCTTCTACAAGGATATGGTGGAGAGAAAGAGAACTTTGCTCATTACAGATTCGCATATATTGGAAGATCCTAGGACTTTGCCAATTGTGCAACAGTTTGCACATGACGCTAGC
TTGTTCCCCAGGAGATTTCCTGAGGTCATGCTTAAGATGAGTTCTTTGAATGTGCTCACAGGGAATGAAGGTGAGGTGAGGAAGATTTGTAGGTCCACCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGACACGGATCTTCCTTACGACCCTTTCATTGTGGCTCTTGGTCCTCGCTCCTTCCAAGGCCGAGGAGGGATTTCCCGACAAACTTCCATCAACATTTCATTCTCTATTTCCG
TTTCTCGGTCGTCAAGATGACCTGAACAAGCCACAAAAGGGTCCTAATGACGAGTCTCAACAACAGAACGTGCCTCAACAAGCGGCTGACCAAAATCCTCAGATACTCAGCCAAGATTTC
TACATTAAGACTTGCCCTAATGCACAAAAAATCGTGGCCGATGCACTTGCCAAGATTGTTAAGACCAATCCGGGCGCACTCGGAAACTTACTCCGCCTTCAATTCCATGACTGCTTCGTT
AAT
GGATGCGATGCATCCATCTTGCTAGATTACTCGCCAAGTGGCGACGCTGTGGAGAAAAGTTCAATGGTCAATGGTCTACTCCTCAAAGGAGCTGATATGATCGATGAAATAAAGTTG
AAGCTGGAGGAGCAGTGTCCTCAAACCGTGTCATGCGCTGACACATTGGCATTTACAGCCAACGAGGTAATGACCATGGCGGGTTTGGCCCCTCAGAAACCCCTCGGTGGCCGTAGAGAC
GCGCTCGTTTCCCTTGCAACCGCTGCAGAAACCGACAACATCCCTATGCCAAACTGGACCATGGAACAAATGGTAAAACTCTTCAACAAGAAGGGTTTCAACATCGAAGAAATGGTGATC
CTACTCGGTGCACACTCGATCGGCATGGCTCATTGCGACTTGTTCATTGAAAGGGCATACAACTTCCAAAACACAGGGAAACCAGACCCTTCCCTTACTGTGGAAGTGCTTGAGGAATTA
AGAAAGGCATGCCCTAATCTTAATACACCTAAGTACCGGAACCCCCCAGTGAACTTTGATGCAACACCAACTGTGCTTGATAACCTCTTCTACAAGGATATGGTGGAGAGAAAGAGAACT
TTGCTCATTACAGATTCGCATATATTGGAAGATCCTAGGACTTTGCCAATTGTGCAACAGTTTGCACATGACGCTAGCTTGTTCCCCAGGAGATTTCCTGAGGTCATGCTTAAGATGAGT
TCTTTGAATGTGCTCACAGGGAATGAAGGTGAGGTGAGGAAGATTTGTAGGTCCACCAATTAA

Retrieve as FASTA