Entry information : GmPrx[P]95 (Glyma01g32220.1)
Entry ID 9030
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-02 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]95 (Glyma01g32220.1)
Name (synonym) GmPrx[P]95 (Glyma01g32220.1)
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]95
start..stop
S start..stop
GmPrx134 401 7.48e-142 5..295 28..320
AhPrx04 330 7.82e-114 4..294 19..309
MtPrx32 327 1.98e-112 6..295 42..334
GmPrx188 325 6.36e-112 1..294 17..309
Gene structure Fichier Exons


exon

Literature and cross-references GmPrx[P]95 (Glyma01g32220.1)
DNA ref. Phytozome 12:   Gm01 (43660275..43662887)
Protein sequence: GmPrx[P]95 (Glyma01g32220.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295
PWM (Da):   %s   32795.81 Transmb domain:   %s   i7-24o
PI (pH):   %s   8.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LQLISANKLRSDFYNSQCPQALEAIKAEITSAVRKEPAMGLAFFRLHFIDCFVQGCDASNLLKDTANFTGEQSAIPSLDSRNGTDIIEKVKARVEKLCPGVVSCADILAVAARDSVVALG
GPTWRVLLGRTDSTTANLSAVTTNLPSPYMDLDEYISCHIRKIKFNSQRNGCFGVQTIGYIKCLFVLRRIYNESNINPTYARALQAKCPLEGCDDNIVPLDIITPNHFDNAYYKNLLKKK
GLLHTDQELYNGGSILCHEPFYATNPLQFRRDFAKAVIKFGNINPLSGTNWQIRK*

Retrieve as FASTA  
Remarks Partial or pseudogene sequence from genomic. Incorrect prediction from Phytozome. (Stop and PS are missing, frame shift).
DNA
Send to BLAST
CDS
Send to BLAST