1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx97 (Glyma01g32310.1)
Entry ID 9032
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-19 (Christophe Dunand)
Peroxidase information: GmPrx97 (Glyma01g32310.1)
Name (synonym) GmPrx97 (Glyma01g32310.1)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx97
start..stop		 S start..stop
GmPrx128 617 0 1..320 1..320
GmPrx130 616 0 1..319 1..319
GmPrx131 614 0 1..320 1..320
GmPrx129 614 0 1..320 1..320
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx97 (Glyma01g32310.1)
DNA ref. Phytozome 12:   Gm01 (43784320..43786579)
Protein sequence: GmPrx97 (Glyma01g32310.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   34618.88 (31784.4) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.72 (4.71) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESRGYLFFLLQGLVFAALATSAFSQLSPNYYDYSCPNALSTIKSVVEAAVQKEHRMGASLLRLHFHDCFVNGCDGSVLLDSTSSIDSEKNAAANFQSARGFEVVDDIKKAVDQACGKPV
VSCADILAVAARDSVVALGGPSWKVSLGRRDSTTASREAADASIPAPFFSLSDLITNFKNHGLDEKDLVVLSGGHSIGYARCVTFRDHIYNDSNIDANFAKQLKYICPTNGGDSNLSPLD
STAANFDVTYYSNLVQKKGLLHSDQELFNGGSTDELVKEYSDDTEDFYEDFANSMIKMGNIQPLTGNQGEIRVNCRNVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA ►
Send to BLAST
CDS►
Send to BLAST