Entry information : GmPrx[P]157 (Glyma06g14270.1)
Entry ID 9035
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]157 (Glyma06g14270.1)
Name (synonym) GmPrx[P]157 (Glyma06g14270.1)
Class Class III peroxidase     [Orthogroup: Prx002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]157
start..stop
S start..stop
GmPrx09 510 0 1..271 56..326
MtPrx07 474 7e-171 1..271 56..326
CclPrx110 434 7e-155 1..271 58..328
CsPrx21 428 1e-152 1..271 58..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11233366..11233413 48 N° 2 11233065..11233256 192 N° 3 11232816..11232980 165 N° 4 11232292..11232725 434
complement(join(11232292..11232725,11232816..11232980,11233065..11233256,1123336 6..11233413))


exon

Literature and cross-references GmPrx[P]157 (Glyma06g14270.1)
DNA ref. Phytozome 12:   Gm06 (11233413..11232292)
Protein sequence: GmPrx[P]157 (Glyma06g14270.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   278
PWM (Da):   %s   29781.67  
PI (pH):   %s   5.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IAAGLVRMHFHDYFIRGCDASVLLDSTSTNTAEKDSPANKPSLRGYEVNDNAKAKLEAVCPGIVSCADIVAFAARDSVEFA*GLGYDVPAGRRDSRISPASDTRTExPPPTFNVNQLTQLFARKGLTED*MVTLSGAHTIGRSHCWAFSSRLYNFSSTSSQDPSLDPSYAALLKRQCPQGSTNPNLVIPMNPSSPGIADVAYYVDILANRGPFTSDQTLLTDAETASQVKQNARDPYLWASQFADAMIKMGQISVITGNAGEIRTNCRVVNGEGLEYLHQ

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome (5' and 3' ends are missing which can not be found and Stops in Frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGCTGCAGGGCTTGTAAGAATGCATTTCCATGATTACTTTATTAGAGTAAGTCATTATATGAAGCCATTTGTTATTTATCTATTCCCCTTAATACTAAAATTTGTTAATTACCCTCTTT
TCTGTAGTAAAACTTTAACCACTATGTTAATTTTAGGGGTGTGATGCATCAGTACTGCTTGATTCCACTTCCACAAACACTGCAGAGAAAGACTCTCCAGCAAATAAACCAAGTCTCCGA
GGGTATGAAGTCAATGATAATGCCAAGGCTAAACTAGAAGCAGTATGCCCTGGAATTGTTTCATGTGCTGACATTGTTGCATTTGCAGCAAGGGACAGTGTGGAGTTTA
TAAGTGTGCCT
ACTTTGTTCTAGAAAGTATAAACATCTTTGAAAGCAAGAAAATGACCTTGTATTATTCCTTGCTTCACGCAGGCTTGAGGGCTTGGCTATGATGTTCCAGCAGGAAGAAGAGATAGCAGA
ATCTCACCAGCTTCAGATACAAGAACAGAGTTNCCCCCTCCAACTTTCAATGTAAACCAACTCACTCAACTCTTTGCTAGGAAGGGACTAACAGAAGATTAAATGGTCACCCTTTCAG
GT
ATACAAGAGCTTCAAGATAACTCTTCTTTATTGTTTTGCTTGTAGCTTAAATTTGCTAATGGTTATGACATGTACTTTGTGCATGCAGGAGCACACACTATCGGCCGCTCTCATTGCTGG
GCTTTCAGCAGCAGATTATACAACTTCAGTAGCACTTCAAGCCAGGATCCAAGTTTAGATCCCTCGTATGCAGCGCTGCTGAAGCGGCAATGTCCTCAAGGCAGCACAAACCCAAACCTG
GTGATTCCAATGAACCCTTCAAGTCCTGGAATTGCTGATGTAGCCTACTATGTTGATATATTAGCAAACCGAGGCCCGTTCACATCTGACCAAACTCTCCTAACTGATGCTGAAACAGCC
AGCCAGGTGAAACAAAATGCTAGGGATCCCTATCTATGGGCAAGTCAATTTGCAGATGCAATGATAAAGATGGGTCAAATCAGTGTCATAACTGGTAATGCTGGAGAGATTAGAACAAAT
TGCAGGGTGGTCAATGGTGAAGGACTTGAGTACCTTCATCAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGCTGCAGGGCTTGTAAGAATGCATTTCCATGATTACTTTATTAGAGGGTGTGATGCATCAGTACTGCTTGATTCCACTTCCACAAACACTGCAGAGAAAGACTCTCCAGCAAATAAAC
CAAGTCTCCGAGGGTATGAAGTCAATGATAATGCCAAGGCTAAACTAGAAGCAGTATGCCCTGGAATTGTTTCATGTGCTGACATTGTTGCATTTGCAGCAAGGGACAGTGTGGAGTTTA
CTTGAGGGCTTGGCTATGATGTTCCAGCAGGAAGAAGAGATAGCAGAATCTCACCAGCTTCAGATACAAGAACAGAGTTNCCCCCTCCAACTTTCAATGTAAACCAACTCACTCAACTCT
TTGCTAGGAAGGGACTAACAGAAGATTAAATGGTCACCCTTTCAG
GAGCACACACTATCGGCCGCTCTCATTGCTGGGCTTTCAGCAGCAGATTATACAACTTCAGTAGCACTTCAAGCC
AGGATCCAAGTTTAGATCCCTCGTATGCAGCGCTGCTGAAGCGGCAATGTCCTCAAGGCAGCACAAACCCAAACCTGGTGATTCCAATGAACCCTTCAAGTCCTGGAATTGCTGATGTAG
CCTACTATGTTGATATATTAGCAAACCGAGGCCCGTTCACATCTGACCAAACTCTCCTAACTGATGCTGAAACAGCCAGCCAGGTGAAACAAAATGCTAGGGATCCCTATCTATGGGCAA
GTCAATTTGCAGATGCAATGATAAAGATGGGTCAAATCAGTGTCATAACTGGTAATGCTGGAGAGATTAGAACAAATTGCAGGGTGGTCAATGGTGAAGGACTTGAGTACCTTCATCAA

Retrieve as FASTA