Entry information : GmPrx[P]171 ( Glyma08g19190.1)
Entry ID 9036
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-12 (Christophe Dunand)
Peroxidase information: GmPrx[P]171 ( Glyma08g19190.1)
Name (synonym) GmPrx[P]171 ( Glyma08g19190.1)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]171
start..stop
S start..stop
GmPrx256 233 6e-77 1..138 1..143
GmPrx256 107 2e-28 103..195 221..298
GmPrx170 210 7e-68 1..127 1..130
GmPrx170 72 0.000000000000003 130..196 234..302
GmPrx05 209 1e-67 1..136 1..139
GmPrx05 72 0.000000000000003 130..195 234..301
AhPrx05 194 9e-62 7..138 12..148
AhPrx05 91 3e-22 103..195 227..306
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14481579..14481964 386 N° 2 14482028..14482279 252  
join(14481579..14481964,14482028..14482279)


exon

Literature and cross-references GmPrx[P]171 ( Glyma08g19190.1)
DNA ref. Phytozome 12:   Gm08 (14481579..14482279)
Protein sequence: GmPrx[P]171 ( Glyma08g19190.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212 (190)
PWM (Da):   %s   23050.76 (20729.5)  
PI (pH):   %s   7.84 (7.83) Peptide Signal:   %s   cut: 23 range:23-212
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGRSSLVFILLALAIVNTVHGTRVGFYSSACPRAEFIVRSTVQSHVRSxDPTMAAGLLRIHFDDCFVQGCDASVLIAGDATERTAFANLGLRGYEVIDDAKTQLEAACPGVVSCADILALAARDSVSLAKQWRFKSGGQNRFDISYLANLRIGHGILQSDQALWNDPSTKSFVQRYLQDGFKGLLFNVEFAKSMFCHQLAIVHVKINLYMA

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Long sequence in frame is missing, 3' end is missing and Gaps in frame which can't be found).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGACGTAGTTCACTGGTGTTTATTTTACTTGCTTTGGCCATTGTGAACACAGTACATGGGACGCGTGTAGGGTTCTATTCGAGTGCATGCCCACGCGCAGAGTTCATTGTTAGG
TCCACAGTTCAATCCCACGTTAGGTCTCTNGATCCTACCATGGCTGCCGGGTTGCTTCGTATTCACTTCGATGATTGCTTTGTGCAAGGTTGCGACGCTTCTGTTCTCATTGCCGGTGAT
GCCACTGAGAGAACAGCATTTGCAAACCTTGGTTTGAGAGGATACGAGGTTATTGATGATGCAAAGACACAGCTCGAGGCTGCGTGCCCCGGTGTTGTGTCATGTGCTGATATTCTTGCT
CTTGCAGCTCGTGATTCCGTTTCTCT
GGTAGTACATAACTCCAAACTATCAAATATCAATGTTTGAATTTATTATCTATTAACTCTGCCCGCAAAACAGTGGCGGTTCAAATCGGGTGGT
CAAAACAGATTTGACATATCTTACTTGGCTAATTTGAGGATTGGCCATGGAATTCTGCAGTCTGATCAAGCGCTTTGGAATGATCCTTCCACAAAGTCATTTGTACAAAGGTACCTGCAG
GACGGCTTCAAAGGTTTGCTTTTCAACGTGGAATTTGCAAAGTCTATGTTCTGCCATCAACTAGCTATAGTGCATGTTAAAATAAATTTGTACATGGCTTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGACGTAGTTCACTGGTGTTTATTTTACTTGCTTTGGCCATTGTGAACACAGTACATGGGACGCGTGTAGGGTTCTATTCGAGTGCATGCCCACGCGCAGAGTTCATTGTTAGG
TCCACAGTTCAATCCCACGTTAGGTCTCTNGATCCTACCATGGCTGCCGGGTTGCTTCGTATTCACTTCGATGATTGCTTTGTGCAAGGTTGCGACGCTTCTGTTCTCATTGCCGGTGAT
GCCACTGAGAGAACAGCATTTGCAAACCTTGGTTTGAGAGGATACGAGGTTATTGATGATGCAAAGACACAGCTCGAGGCTGCGTGCCCCGGTGTTGTGTCATGTGCTGATATTCTTGCT
CTTGCAGCTCGTGATTCCGTTTCTCT
CGCAAAACAGTGGCGGTTCAAATCGGGTGGTCAAAACAGATTTGACATATCTTACTTGGCTAATTTGAGGATTGGCCATGGAATTCTGCAGTCT
GATCAAGCGCTTTGGAATGATCCTTCCACAAAGTCATTTGTACAAAGGTACCTGCAGGACGGCTTCAAAGGTTTGCTTTTCAACGTGGAATTTGCAAAGTCTATGTTCTGCCATCAACTA
GCTATAGTGCATGTTAAAATAAATTTGTACATGGCTTA

Retrieve as FASTA