Entry information : GmPrx[P]247 (Glyma14g17370.1)
Entry ID 9040
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]247 (Glyma14g17370.1)
Name (synonym) GmPrx[P]247 (Glyma14g17370.1)
Class Class III peroxidase     [Orthogroup: Prx020]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]247
start..stop
S start..stop
GmPrx59 352 1.07e-121 24..333 14..326
LjPrx70 327 3.6e-112 24..333 15..327
CpapPrx22 298 1.08e-100 32..333 19..323
CsaPrx85 270 1.81e-89 31..333 18..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9040' 'complement(join(19204348..19204730,19205340..19205439,19205477..19205542,19208591..19208811,19208912..19209139))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19208912..19209139 226 N° 2 19208591..19208811 219 N° 3 19205477..19205542 64 N° 4 19205340..19205439 98
N° 5 19204348..19204730 381  
complement(join(19204348..19204730,19205340..19205439,19205477..19205542,1920859 1..19208811,19208912..19209139))


exon

Literature and cross-references GmPrx[P]247 (Glyma14g17370.1)
DNA ref. Phytozome 12:   Gm14 (19209139..19204348)
Protein sequence: GmPrx[P]247 (Glyma14g17370.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330
PWM (Da):   %s   36044.01  
PI (pH):   %s   8.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IYIGTLATTFLSAFPTANQTCTNLLLLIADCHAQLGVD*HRNTCPNVESTVRSAVEMKLQRKFVTAPATLFFPDCLFMCMCMLDRDVMLLASRNNTSDKDNLINFSLAGDGFDTDQSQGC
D*xLDCVGGCHNKVSCADILAMATRDVIALIGGPSYSVELGRLDGRITTKASCLHHLPHPEFKLAQLNQMFASHGLTLTDLVVLSGAHTIGFSHCSKFQTDLQLQKKEKH*SHTSSRVCK
TAPTSVSEQPLTWTLLPLGHLITNTTRIFRRKWTLAFNQTLFTHKGPRHLVNLFASNSTAFETSFVSAITKFRRIGVKTGNQGEFSCDCTMAN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (5' end is missing. Gaps in frame. Stops in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTACATTGGAACGCTAGCCACTACATTTTTAAGTGCATTTCCAACTGCAAACCAAACATGCACGAATCTTCTGCTGCTAATAGCTGATTGTCATGCTCAACTTGGAGTTGACTAACATA
GGAACACATGTCCAAATGTTGAATCAACTGTACGCAGTGCAGTTGAGATGAAACTTCAACGGAAATTTGTGACAGCTCCTGCTACACTCTTCTTCCCTGATTGTCTAA
TTGTTAGGGTCA
TCACAGTTATTATTTATAGTCTGTATTTTTTTTTTCTTTGTATGCACCCTTTGGCAATAGGTGTTAGTGTTACTAAATTTTATGTGTTTTTTATGTGCATGTGCATGTTGGACAGGGATG
TGATGCTACTAGCTTCAAGAAACAACACATCAGACAAGGATAATCTCATCAATTTTTCACTAGCTGGTGATGGGTTTGACACTGATCAAAGCCAAGGCTGCGACTGACANCTTGACTGTG
TAGGTGGCTGCCATAATAAGGTTTCATGTGCTGACATATTGGCAATGGCAACTAGAGACGTCATAGCATTG
GTAAATAAGCAACAATAGCCTTGGCAAAATAGAGAGCTTCCAATTAATA
TTCATAAATTGGATTCTTTATAAACTAAGTTCATCAATCATAGTATACTAGTTGTCTCTATAATAAGTAACAGTGGGGTAGAATTAGAGAACGCAAAATGAATTAGAATTGGCAATGGCA
ACTAGGGATGCTATAGAATTGGTAAATAAGGAATGTCCTTTGCAATAAAGCAAAGCTTACATGCATTTCATTAAGTACTTTTTTTTTAGGAAGATTCCTTCAGTACTTTTGGTACTGTTT
TCAAATCAAAATTAGAGTTTCATTGCATTAAAAGTCAACATAAATTACTGAGGTAAAACTCTAAATATGATTTGAAAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAACAACACCAAAAGTACTTAAGGAAATATCTTCAAGTTTTGCATATACGTAAATTGTATCATCTGTAAAA
TAAGTTCAATTAAAGTGTAGTAGTTGTCTGAGCATCCACCTCTAGCAAATGCAGCATATCTATACAAGTAATAATGGGGAATTAGACAAGTATTACTATGAGACTATGACCCCTGCGACA
TCATATTCTTTTGATTTGTCTTTATAATATTATTTTATATTGGTTAGGTGGAAAATTATATGTAAAATTTTAGTTGTACAATTTAGCTCAATACCAAATGAACATTCACTTGGTTTCAGA
TATAGGAGGGCCATCTTATTCAGTAGAATTGGGAAGGCTAGATGGGAGAATCACTACAAAAGCTAGTGTTTAAGGCTAGATGGGAGAATCACAACAAAAGCTAGTGTGTTTGCACCATCT
ACCTCATCCTGAATTCAAACTAGCACAGCTGAACCAAATGTTTGCTTCACATGGCCTCACCCTTACGGATCTAGTTGTTCTATCAG
GTATTTCATTCATAATGAACAAAATACTTGTTAG
TTAACCCAAGAGTCTAAGTTCATGTTTGGATATACATTGGCATGGCAAAAACCTACATTCTGCACTAGGGAAGGTAGATATAGCCAATTTCCAACATGTTTGGTTTTATGTTTGAATCAA
GTGACAAATGGGATTTTAACTCTAAACTCAATTTTTAGACGTAACAACTAGCAAGTCTTGTGCAAGTTTTGCATTAGGTTGAAAATTTATACTAAGTTTCATTACAAACTTACTTTTAAG
ATAAAAGTTTCCTCATATAATCACTTCGTCCCAAACTCTTTGGGGAAATCAATTTTACAAGTAAAAAAAAAGACCAAACCAAGTTTGCAATGCCCACCTTTTTTGGAATTGAAATCTGAC
CTCTTCCAAAAAATGGTTTTACTTACGTGCACCTAAAATCAAACTCCTATCCACATGCTTGAGGAATATGGTTATTTGTCAACCGTACCACACCATGTTTATTTCACTAATGCCTATTTG
AACACACACACTAAGACTTAGTATTGTTGTGTAGTGTACCATTTGGCTTCTTCATCCCCGAAAATTATAATCTAGATTGCAATGAGTGGTTACAGGAGAGCACATACTATTGGGTTCTCC
CACTGCAGCAAGTTCCAAACAGATTTACAACTTCAGAAGAAGGAAAAGCATTGATCACACACTTCATCTCGCGTATGCAAAACAGCTCCAACAAGTGTGTCGGAACAGCCATTGACATGG
ACCCTATTACCCCTAGGACATTTGATTACCAATACCACGAGAATCTTCAGAAGGAAATGGACTCTTGCTTTTAATCAAACTCTATTTACTCATAAAGGACCAAGACACTTAGTGAACTTA
TTTGCATCCAACAGCACAGCCTTTGAAACGTCTTTTGTAAGTGCCATAACAAAGTTCAGGCGGATTGGGGTCAAAACGGGAAACCAGGGTGAATTCAGCTGTGATTGCACAATGGCTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTACATTGGAACGCTAGCCACTACATTTTTAAGTGCATTTCCAACTGCAAACCAAACATGCACGAATCTTCTGCTGCTAATAGCTGATTGTCATGCTCAACTTGGAGTTGACTAACATA
GGAACACATGTCCAAATGTTGAATCAACTGTACGCAGTGCAGTTGAGATGAAACTTCAACGGAAATTTGTGACAGCTCCTGCTACACTCTTCTTCCCTGATTGTCTAA
TTATGTGCATGT
GCATGTTGGACAGGGATGTGATGCTACTAGCTTCAAGAAACAACACATCAGACAAGGATAATCTCATCAATTTTTCACTAGCTGGTGATGGGTTTGACACTGATCAAAGCCAAGGCTGCG
ACTGACANCTTGACTGTGTAGGTGGCTGCCATAATAAGGTTTCATGTGCTGACATATTGGCAATGGCAACTAGAGACGTCATAGCATTG
ATAGGAGGGCCATCTTATTCAGTAGAATTGG
GAAGGCTAGATGGGAGAATCACTACAAAAGCTAGT
TGTTTGCACCATCTACCTCATCCTGAATTCAAACTAGCACAGCTGAACCAAATGTTTGCTTCACATGGCCTCACCCTTACGGATC
TAGTTGTTCTATCAG
GAGCACATACTATTGGGTTCTCCCACTGCAGCAAGTTCCAAACAGATTTACAACTTCAGAAGAAGGAAAAGCATTGATCACACACTTCATCTCGCGTATGCAAAA
CAGCTCCAACAAGTGTGTCGGAACAGCCATTGACATGGACCCTATTACCCCTAGGACATTTGATTACCAATACCACGAGAATCTTCAGAAGGAAATGGACTCTTGCTTTTAATCAAACTC
TATTTACTCATAAAGGACCAAGACACTTAGTGAACTTATTTGCATCCAACAGCACAGCCTTTGAAACGTCTTTTGTAAGTGCCATAACAAAGTTCAGGCGGATTGGGGTCAAAACGGGAA
ACCAGGGTGAATTCAGCTGTGATTGCACAATGGCTAAC

Retrieve as FASTA