Entry information : GmPrx[P]261 ( Glyma15g13530.1)
Entry ID 9043
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-01-12 (Christophe Dunand)
Peroxidase information: GmPrx[P]261 ( Glyma15g13530.1)
Name (synonym) GmPrx[P]261 ( Glyma15g13530.1)
Class Class III peroxidase     [Orthogroup: Prx043]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]261
start..stop
S start..stop
GmPrx47 637 0 1..344 1..344
GmPrx24 551 0 1..344 1..347
GmPrx262 515 0 1..322 1..322
GmPrx260 479 5e-171 16..344 15..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10131587..10131799 213 N° 2 10132527..10132718 192 N° 3 10135345..10135497 153 N° 4 10135994..10136542 549
join(10131587..10131799,10132527..10132718,10135345..10135497,10135994..10136542 )


exon

Literature and cross-references GmPrx[P]261 ( Glyma15g13530.1)
DNA ref. Phytozome 12:   Gm15 (10131587..10136542)
Protein sequence: GmPrx[P]261 ( Glyma15g13530.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368 (344)
PWM (Da):   %s   39487.48 (36874.1)  
PI (pH):   %s   4.32 (4.26) Peptide Signal:   %s   cut: 25 range:25-368
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLRLTLCCVVVVLGALPYFSYAQLDPSFYDSTCSNLSSIVREVLTNASLSDPRMPASLIRLHFHGCFVQGCDASILLNQTDEIDSEQTAFPNDNSIRGLDVVNKIKTRLENACPGIVSCADTLALAAEVSSELACGPVWEVPLRRRDGFSANQTLANENLPAPSLCIDQLISAFANQGLNITLIVSFLGAHTIGRAQCKFIVDRLYDFNGTGNPDPTLNTT*LESLQVICSNGGPESDLTNLDLTTPGTLDSSYYSNLQLQKGLLQSDQELLSANGTDIVAIVNSLTSNQTFFFENFAASMIKMANIGVLTGSDGEIRTQCNFVNGNSSALTTKESSQDGMVRWAKVMLENAGIKGGVNKEFCVCMW

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from Phytozome. (Stop in frame, several "n" and VALS in different frame (=>extra CT)).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTCCCTTCGTCTCACTTTATGCTGTGTGGTGGTAGTGCTTGGAGCACTACCCTACTTCTCATATGCACAACTAGATCCCTCGTTTTACGATAGCACATGTTCAAATTTGAGTTCA
ATCGTACGTGAGGTGCTCACAAATGCTTCCCTGTCTGATCCCCGCATGCCTGCCAGTCTCATCAGGCTCCACTTTCACGGTTGTTTTGTACAA
GTAACTACCTATATTCTTCATATCTTA
ACTCCATAATGTGATATGTAGTTTTTTTTTTCTTTTTATTTTAAACTAAATCCTTTCCTGGCTACTTCTGTTACCCCGAGAATAACTCATTCATAAACTTTTTTTTTATATTACATAGTT
GAAATGTATATATGTGGATTCATGAACGGAGGAAAGCCTCAAACCACTTCTATAGAAATTTTACTATTTTAAAGAGTAGATGTGTTTGAGTTCTATTTTTAAAACTGATTTTAGTTTCAA
CCTAAATAAGACTGCTCATACTACAGTTGGTAAAGGCTGGTTCACGATATACCACATAGGTCAAAGTGTAAAATTGAAAGAGCAGTTGAATAAGATAAAATCAAAAACATGAAGATGAGA
AAATTAAATACCTCCTAGCTATTTTTTCTTTTGGTTTTTAAGACACTTATTTTAGAAACAATTTAAAATTTATTAGATTTAATTAATAATTAATGAGTGATGTAAAATCGTTTTAGAAAA
TAATTTTTTAAATGAAACAATGAGAAGGGGATCAATCAAACATGTCTTTGGTCCCCTCCATCAATTTTATGCGTAAAAGGAAACGCAGTTTGAAATGTCAAGCTTTCCTTATGGGCACTG
ATAAATCAAGAGTTAATTAAATAAGAGAAAGAGTGTTTTGTTTTAATATGACTCAAATTTCTTGTTGCTGAGAATTGAAGTGAATTATATATGTTTCCAGGGGTGTGACGCATCAATTCT
ATTGAACCAAACGGATGAGATCGATAGTGAGCAAACTGCTTTTCCAAATGACAACTCTATAAGAGGGTTGGATGTTGTGAACAAGATAAAGACCAGGTTGGAAAATGCTTGTCCTGGCAT
AGTTTCTTGTGCTGATACTCTTGCCCTAGCAGCTGAAGTATCTTCTGAGCTG
GTATATATATGCATTTTAATTAATTTGTTTAATAAATCTCTAGTTTAATTTATAGAAAATCAAAATAT
TGAGTATTATTATGAAAAGGGAAAAATATATATGTTTTTAGTCTCTCTAAAAAATATTAAATTTAATTTTTTTTCTCTAAAAAAATTGTTCTATTTTTATATCCTCAACTTTTACTCTTT
AAACTAGTTATAATTAATATTTTATGACGGTTTGTAACTGTATTGTCAAAAAATATACTTTTGAGGCTAAAAATAGAATATTTACATGTTAGAGAACAAAAATAAGGAAAAAAATTGGAC
GGCCAAAGCCGATTTTAAGAAAATTTAGAAATATCAAAAATATATTTTATTCGTATAAAAATAAGAAAAACCAATGTTCCATACAGTTTTAGTTTGATTTCCTTTACAGTTTTGGTTTGA
AAAATCTGATTTTTAAACTAATTATTTGATCCAACTCAATAATTAATTTCTAATCCAAAATCTATTCAATTTAAAGATATTTTTTAAAAAAGTGTTTTAAAAACTAAAAAAAAACATAAA
TATATGAGAAATTAATGTTTTCTCAACAGTTTCTTTTTCTTATTCTATAGGATATGGATCATATGAAGTGATATTGCATGTGGTGAGGTATGAACTTGGTATTGATTTTTGTTTTCTTTC
TTTAAAAAATCAAAAATAGAAATCAAACGCGCCTTGAAGTTTCAAAATATTGTTTGGAAATTCAATGGAAACCTATATATAAAACTAGAGACAATAATTAACTTGATATGTGATAGGATT
TTTTTTTTCTAAATGGCCTAAGAAAGAAACACCTCAGACACAAATTAATTAATACTCAACTGATATGTGATAGGAATATAAATAAGATGAGTTGTTTATAAACTATTTGTTTTATAGGTT
AGTTATTTATTCAACTTTAATAATTTTTTAAATAAATTAATAATCTCAAATTTATAGTTAGATTTAACTATTTTAAATAAGTGAAATCTAAGTTTTGTAGGCTTGACATTAATATTTCAT
GAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTTATATAATTATTTAATTACAAATTACTATGATATGTCACACGCACAAATAATGACTA
TATATTTTATTATAATTTCACTTTATTTTAGCACAAAGATATCAATTATATACTAAATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAAGACACCT
TAATAAGTTAATAACTCAACCTCAAGTTTTTTCACTTGGTTCAACTCATTTACATCGTGAAATTTGATAAAAACAAAGAAAGTTATAAGTTAGTGAGTTTGAAGGACGCGAGGTTAGAAA
TTAAAGAATGAAAATTCTAAAGAAATTATTTTTATGTAAAATTTGATGTTTTAGTTAGTGAGTATGAGTAAAAGAAAATTTAAAATAATTTAACTGATTCAATTTGTTAAATTTTTAAGT
AGAAAATGAGAATTTGAAGATTTTAGGTAGAAGAATTATTTTTTTTAAGAAATCTAGAAGAAAGCTGGAATGATCAATTTTGCTTAATATTCAAAATAAAACTGATTTGAACATAATTTT
AAAAAATCAAAATCAGAAATAATATAAATTAAAGAGATCACAGGTATAATTAGCTTCTTTTTTAATTTATATTCGCAATGAAATTGGACTTCTCGCTTTTTTTGTTCGTGATTCATGCAA
AGGTTAATTTCTTTGATTTAATTTATTTGTCCATTTCGAATTTTAAGATAATATTTACTACTTTTTTTAATAATACTTTTATTCTCACGTTATCATTAAATATTTTACAGTCTTATCNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTATATATTATCCTCCTAAATAAACATAT
AAAAAGAAACAATTGTACTAGCTATACTATTTCCTCTTTCCATGCAAATGGAGAAGCGGACTCTAGTTTATATATATAAATTATCCAGGTGTTGACACATGTCAATTTTCAGTGTAATTT
TTTCTAGTCTTACTTATTTTATCGTTTTCTATTTGCAATAATAATTTTACTGCTTTGATTTTCTTCTGTGTCGAGCACGGGATTATTGATCTAATAGTTATATAAATCTGTCTAAAGAAA
AAGAAAGAAGTAGAGGAATTTTCTCTATGTATTTTTATGGTGCTTTTAGAATTTATGCAGAGCAGTTGTGAAAAAATTGATTTATTAAAAAATTGATTGCCCTTCATTTTGTTTTAACTT
TAATCTTAATATAATCTTATTAAGAAAACAATATATTTGTTTTTAGGATTTTTGGTGGTCTACTTTAAATTATGAGTATGCTCACATATTGGGTCATTATTTAACAAGAATAAAGAAAAT
AAGAATGGAGAGGCGGAATTGATTCAAACAAATCATTGCCAAAGATATAACTAAATTTCTTGGTGGAATTTTAATCTTAATTGAAACCATAAGTTCTCAACAACAAAAAAATTCACCTTT
TGCATTCTATTTTGTCCACCTTTTGTACTGTTTGGCAGGCTTGTGGTCCTGTTTGGGAAGTTCCATTAAGAAGAAGGGATGGTTTCTCAGCAAATCAGACCCTTGCTAATGAAAATCTTC
CAGCTCCTTCTCTTTGCATTGATCAACTTATATCCGCATTTGCTAATCAAGGCCTCAACATTACACTGATT
TAGTTGCACTTTCAGGTATGAAATTTCTTACATTTAATAAATAAATAAA
AGGTTTTATAGTGTGTGATTACAAGCACAGTATATTCAATATATCTTGTCAAATGCTTTAAATTGTTTAAATAAGTAATGATTAAACGTCATGAGTTTTTTATATAGCCGTACATACATC
CATTTTGCTACTCTTGTTTTTATTACTTAACCAATAATTTAGATACATTTTATCAAATTTCTTTTTGGTAATCTATGCTCTTGTATATAATCAAATTTAATTAGACAAGAGTAGAAATGC
ATATAATTAAATGACAATATCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATTT
CGAAGAATGTTCTTGTAGCCAAAAAAGCAATGAAATTAAACCCTTTAATAAGAATGGTATTATTTTGTTGTATTACTTATTGAAAATGTCTCATTTTTAGGTGCTCATACTATTGGTAGA
GCTCAATGCAAGTTTATTGTTGATCGATTGTACGATTTCAATGGCACTGGCAATCCAGATCCTACTCTCAACACAACTTAATTAGAATCATTGCAAGTAATATGTTCCAATGGTGGACCT
GAGTCTGATCTTACCAATTTGGACTTAACCACTCCTGGCACGTTGGACTCGAGTTACTATTCCAATCTTCAACTTCAAAAGGGCTTGCTTCAGAGTGACCAAGAGCTTCTTAGTGCAAAT
GGTACCGATATTGTTGCCATTGTTAACAGTCTCACTAGTAACCAAACTTTTTTCTTTGAAAACTTTGCAGCATCAATGATTAAAATGGCCAACATTGGAGTGCTAACGGGATCAGATGGA
GAAATTCGAACACAATGTAATTTTGTGAACGGAAATTCTTCTGCCCTTACCACCAAAGAATCATCACAAGATGGCATGGTTAGATGGGCAAAGGTTATGCTGGAAAATGCTGGGATTAAA
GGAGGTGTCAATAAAGAGTTTTGTGTGTGCATGTGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTCCCTTCGTCTCACTTTATGCTGTGTGGTGGTAGTGCTTGGAGCACTACCCTACTTCTCATATGCACAACTAGATCCCTCGTTTTACGATAGCACATGTTCAAATTTGAGTTCA
ATCGTACGTGAGGTGCTCACAAATGCTTCCCTGTCTGATCCCCGCATGCCTGCCAGTCTCATCAGGCTCCACTTTCACGGTTGTTTTGTACAA
GGGTGTGACGCATCAATTCTATTGAAC
CAAACGGATGAGATCGATAGTGAGCAAACTGCTTTTCCAAATGACAACTCTATAAGAGGGTTGGATGTTGTGAACAAGATAAAGACCAGGTTGGAAAATGCTTGTCCTGGCATAGTTTCT
TGTGCTGATACTCTTGCCCTAGCAGCTGAAGTATCTTCTGAGCTG
GCTTGTGGTCCTGTTTGGGAAGTTCCATTAAGAAGAAGGGATGGTTTCTCAGCAAATCAGACCCTTGCTAATGAA
AATCTTCCAGCTCCTTCTCTTTGCATTGATCAACTTATATCCGCATTTGCTAATCAAGGCCTCAACATTACACTGATT
GTCTCATTTTTAGGTGCTCATACTATTGGTAGAGCTCAATGC
AAGTTTATTGTTGATCGATTGTACGATTTCAATGGCACTGGCAATCCAGATCCTACTCTCAACACAACTTAATTAGAATCATTGCAAGTAATATGTTCCAATGGTGGACCTGAGTCTGAT
CTTACCAATTTGGACTTAACCACTCCTGGCACGTTGGACTCGAGTTACTATTCCAATCTTCAACTTCAAAAGGGCTTGCTTCAGAGTGACCAAGAGCTTCTTAGTGCAAATGGTACCGAT
ATTGTTGCCATTGTTAACAGTCTCACTAGTAACCAAACTTTTTTCTTTGAAAACTTTGCAGCATCAATGATTAAAATGGCCAACATTGGAGTGCTAACGGGATCAGATGGAGAAATTCGA
ACACAATGTAATTTTGTGAACGGAAATTCTTCTGCCCTTACCACCAAAGAATCATCACAAGATGGCATGGTTAGATGGGCAAAGGTTATGCTGGAAAATGCTGGGATTAAAGGAGGTGTC
AATAAAGAGTTTTGTGTGTGCATGTGG

Retrieve as FASTA