Entry information : GmPrx[P]267 (Glyma15g18780.1)
Entry ID 9044
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]267 (Glyma15g18780.1)
Name (synonym) GmPrx[P]267 (Glyma15g18780.1)
Class Class III peroxidase     [Orthogroup: Prx157]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]267
start..stop
S start..stop
LjPrx47 304 2e-104 6..247 1..315
GmPrx183 283 6e-96 1..247 7..327
GmPrx76 263 4e-88 2..247 11..329
MtPrx09 260 4e-87 2..247 11..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15653999..15654160 162 N° 2 15654582..15654766 185 N° 3 15655087..15655483 397  
join(15653999..15654160,15654582..15654766,15655087..15655483)


exon

Literature and cross-references GmPrx[P]267 (Glyma15g18780.1)
DNA ref. Phytozome 12:   Gm15 (15653999..15655483)
Protein sequence: GmPrx[P]267 (Glyma15g18780.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247 (232)
PWM (Da):   %s   27416.69 (25586.8)  
PI (pH):   %s   4.91 (5.07) Peptide Signal:   %s   cut: 21 range:16-247
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AYFWLVNFFILACELTPDFYKTTCPDLYRIVRSEVQKALKYEMRMGASLLRLHFGCDGSVLLDGGQDSEKFATPNLNYARGFEVIDTIKSSVERACSGVVSCADILAIAARDSVLLKCTFFSVRLFNFSGTQAPDSTIETTMLSELQNLCLQNGDGNTTSVLDQGSVDLFVNHYFKNLLDGKGLLSSDQILFSSENATATTKPLVQFYSVNERVFFVEFAYAMIKMGNINPLTGYEGEIRRNCRVVN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Inocrrect prediction from phytozome (5' end is missing and can't be found; Big gap in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCATATTTCTGGCTTGTGAATTTCTTCATTTTGGCTTGTGAATTGACCCCAGATTTTTATAAGACTACATGCCCAGATCTTTATAGAATAGTTAGAAGCGAGGTTCAAAAAGCTCTAAAA
TATGAGATGCGAATGGGTGCTTCTTTGCTTCGGCTTCACTTC
CATGATTTCTTTGTAAATGTAAGTCCATGTGGCAGTTATTTGCCTATTCATTGATTTTTTTGTTAAGGACCCAGAGAA
TATTAGCAACGAACTTTTGAATACACCCTTTTGATTTATTAAACGAAAATGATTAGAAATCACATTTTTTTTTTTCTGAATTTCACTTCTTATGTAATTATTCTCACTCATAATTTTGTA
ATTTTTAATAACTTATAACTAATAATAGTGTCTTGGAAGAAGTGAATAACACTCATCAGTGGATTGATATAATCAATATTGAATTGTTTAAAACTTGGTCATTCCGCTAGAAAACATTTG
GATGGATATAATATAGTACTAATTAATTTATGTAATAGGAATTGTCAACCTTTTTCTCTTCTTTTACTTTATTGTTTATCTAATTAATATATTTGGGTCTCAGGGTTGTGATGGTTCAGT
TCTGCTGGATGGAGGCCAAGATAGCGAGAAATTTGCTACTCCTAATTTGAATTATGCTAGAGGATTTGAAGTTATAGATACAATCAAAAGTTCAGTGGAGCGTGCATGTAGTGGAGTTGT
GTCCTGTGCTGATATATTAGCCATAGCTGCCAGAGATTCTGTTCTCCT
TGTATGTTCAATGATAAAATATTGATCATTCATTAAAAAAAAAAAAACCCTCTTGGCAATGATTTCTCCCTA
TTAATCGTCATGCTGATTTAAGTACGAAATTATTTCAACTTAATTGATATTTAAAGGAAGAATTTGTTAGTGATAATTATCTTATAAGACGCTAACAAAATTGTATAATTGTTGCTCAAC
ATGATAAGCTACTCTATAGTCTAGCAAAATGTTAGTACATTTGTTGCTTGCTTCTTATAATTCAATATATTATTACTAATATCTATTTATCTATTTATATGTATCAGGTTTCCACACTAT
TTGACGAGGAAGTGCACTTTTTTCAGTGTTAGATTGTTCAACTTCTCAGGGACACAAGCACCAGACAGTACAATAGAAACCACTATGCTGAGTGAGTTGCAAAATTTGTGCTTACAAAAC
GGTGATGGGAACACAACCAGTGTGCTAGACCAAGGGTCAGTGGATCTATTTGTTAACCACTACTTCAAGAACTTGCTCGATGGGAAGGGTCTTCTTAGCTCTGACCAGATTCTCTTTTCC
AGTGAAAATGCCACGGCAACTACTAAGCCTTTGGTCCAATTTTATAGTGTTAATGAGAGAGTTTTCTTTGTAGAATTTGCCTATGCCATGATCAAGATGGGGAATATAAATCCTCTAACT
GGTTATGAGGGTGAGATTCGGAGGAACTGCAGAGTAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCATATTTCTGGCTTGTGAATTTCTTCATTTTGGCTTGTGAATTGACCCCAGATTTTTATAAGACTACATGCCCAGATCTTTATAGAATAGTTAGAAGCGAGGTTCAAAAAGCTCTAAAA
TATGAGATGCGAATGGGTGCTTCTTTGCTTCGGCTTCACTTC
GGTTGTGATGGTTCAGTTCTGCTGGATGGAGGCCAAGATAGCGAGAAATTTGCTACTCCTAATTTGAATTATGCTAGA
GGATTTGAAGTTATAGATACAATCAAAAGTTCAGTGGAGCGTGCATGTAGTGGAGTTGTGTCCTGTGCTGATATATTAGCCATAGCTGCCAGAGATTCTGTTCTCCT
GAAGTGCACTTTT
TTCAGTGTTAGATTGTTCAACTTCTCAGGGACACAAGCACCAGACAGTACAATAGAAACCACTATGCTGAGTGAGTTGCAAAATTTGTGCTTACAAAACGGTGATGGGAACACAACCAGT
GTGCTAGACCAAGGGTCAGTGGATCTATTTGTTAACCACTACTTCAAGAACTTGCTCGATGGGAAGGGTCTTCTTAGCTCTGACCAGATTCTCTTTTCCAGTGAAAATGCCACGGCAACT
ACTAAGCCTTTGGTCCAATTTTATAGTGTTAATGAGAGAGTTTTCTTTGTAGAATTTGCCTATGCCATGATCAAGATGGGGAATATAAATCCTCTAACTGGTTATGAGGGTGAGATTCGG
AGGAACTGCAGAGTAGTTAATTAA

Retrieve as FASTA