Entry information : GmPrx[P]269 (Glyma15g39210.1)
Entry ID 9046
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2015-12-26 (Christophe Dunand)
Peroxidase information: GmPrx[P]269 (Glyma15g39210.1)
Name (synonym) GmPrx[P]269 (Glyma15g39210.1)
Class Class III peroxidase     [Orthogroup: Prx031]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]269
start..stop
S start..stop
GmPrx167 590 0 8..328 18..340
MtPrx18 523 0 7..328 11..335
PpePrx49 443 1e-157 19..326 20..335
CsaPrx34 432 2e-153 29..326 38..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45812908..45813144 237 N° 2 45814138..45814884 747  
join(45812908..45813144,45814138..45814884)


exon

Literature and cross-references GmPrx[P]269 (Glyma15g39210.1)
DNA ref. Phytozome 12:   Gm15 (45812908..45814884)
Protein sequence: GmPrx[P]269 (Glyma15g39210.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327
PWM (Da):   %s   36090.85  
PI (pH):   %s   8.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GSTTLPLSIIYGLSTQGNAPKKSFKPLLPPEALLSIGHYHTTCPDVEGIISQKVAAWVKKDPTLAPAIIRLHFHDCAVGGCDASILLNHPGSERTALESRTLRGFQLIDNIKIELEKRCPRIVSCADILTAAARDATLMAGGPFWEVPFGRKDNKISLAREANMVPHGHENITALIAFFQEKGLDILDLVTLSSSHTIGRSICSSIMDKIYNFNRTGKPDPSLNVYFLKLLRKRCKRVMDLVHLDVITPRTFDTTYYTNLMRKVGLLSTDQSLFSDARTAPFVEAFAT*PFLFTSQFSVSMVKLGNVHVLTRPNEGEIRVNCNYVNIV

Retrieve as FASTA  
Remarks Pseudogene from genomic (intron 1). Incorrect prediction from phytozome (Stop in frame. 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCTCCACTACCTTGCCGTTAAGCATCATTTATGGTCTTTCTACACAAGGAAATGCGCCTAAGAAATCATTCAAGCCCTTATTGCCCCCTGAGGCCTTGCTGTCCATTGGTCACTATCAC
ACAACATGTCCTGATGTTGAAGGCATCATCTCACAAAAGGTTGCAGCTTGGGTTAAGAAGGACCCTACATTGGCCCCTGCCATCATACGCCTTCATTTCCATGACTGTGCTGTTGGG
GTA
ATCACATATCTCAATCTCTCTTTAAATTTGGCAATGTGTTTCCTATGCTTGTTTCTTGCTTACTTGGAATAAGGTACACTTGAATTGGCCACATGCATATTGATTCATGCATCACGGATC
ACTTTAATTTGCTAGGTGTCATTTGATACATATGATGGACCATTAGAAAAAATAGAGTGTTTAGTGTTTATTTGGAGATAAATATTCCTATTTGATTTGGATCATTTTGACTGTTGTAGC
CAAACATGGTTGAAATCCAGCATTTAAAATACATTCTCATTATAAATTTTTTTGCACTGTAATCTAATTACAAATAATTTTAGATATGACTTTTAAAGTAATTATTATTAAATCACAATC
TTACCAAACATGATCAGTTATGATTAGACTAGAATTAAAATATACAAGGATAAGATGACAATTTGAGGTAGAATATGATCTGTCACATGACCATCTTTATAAGATGTTCGTAATAACTGT
AATGTTGTTGGGACCAGAACTTACTTCTGGTTTGAAAATAGGATCACATGCAGATCTTGGTCTCTTCATTGTGTGGATGATGACAATCAAAACTTACTTGAAACACATAAAATAAATAAC
CGGACCATGACCATTTGCACTTTTATTTCTTCAACATCATTAACCTTCCATTCCTCACTATTTTTCTCCTCACTTTTACACTATTTTTGAGTACTTATTTTACTTCATAGAAAAAAAAAA
TACTTTTATTATCTAAAATGAAGTGAATTACATTGTAGTAATATTAGTCAACACATATATAAGTATAACACATTATTAGTTAATAGTTAACACATGTAAATAGATGACAACTTAAAAAAA
TTCAGAGTGCGAGATTCTAGTTAAACTCCTAACTATATTAACCTATATTATGATTTAACATTTTAAGATTGTAATTAGAAATGTTGATTGAAGTGAATGTGACATGAAACACTTTGTTTG
ATACACTTCAATTGATCAAATACAATGCAGGGATGCGATGCATCAATATTGCTCAACCATCCAGGAAGTGAGAGGACTGCATTAGAGAGCAGAACCCTGAGAGGCTTCCAATTGATTGAT
AATATCAAGATTGAGTTAGAAAAAAGGTGTCCAAGAATAGTCTCTTGTGCTGACATTCTCACTGCTGCAGCAAGAGATGCCACTCTTATGGCTGGAGGACCATTCTGGGAAGTCCCATTT
GGCAGAAAAGATAACAAAATTTCCTTAGCCAGAGAGGCCAATATGGTTCCTCATGGCCATGAAAACATCACAGCCCTTATTGCATTCTTTCAAGAAAAAGGGTTAGACATTCTTGACTTG
GTCACTCTCTCGAGCTCACACACAATTGGGAGGAGCATTTGCTCTTCTATCATGGATAAGATTTACAACTTCAATCGGACTGGAAAGCCTGACCCTTCGCTCAATGTCTATTTCTTGAAG
TTGTTGAGGAAAAGGTGCAAAAGGGTGATGGATTTGGTGCACCTTGATGTCATAACCCCTAGGACTTTTGACACAACCTATTACACTAACCTTATGAGGAAAGTGGGGTTGTTGTCAACA
GATCAGTCACTGTTTTCAGATGCAAGGACGGCTCCTTTTGTTGAAGCATTTGCAACATAGCCTTTCCTTTTTACTAGCCAGTTTTCAGTGTCAATGGTGAAGCTAGGGAATGTTCATGTT
CTGACTAGGCCTAATGAAGGTGAAATCAGAGTTAATTGCAATTATGTCAATATTGTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGCTCCACTACCTTGCCGTTAAGCATCATTTATGGTCTTTCTACACAAGGAAATGCGCCTAAGAAATCATTCAAGCCCTTATTGCCCCCTGAGGCCTTGCTGTCCATTGGTCACTATCAC
ACAACATGTCCTGATGTTGAAGGCATCATCTCACAAAAGGTTGCAGCTTGGGTTAAGAAGGACCCTACATTGGCCCCTGCCATCATACGCCTTCATTTCCATGACTGTGCTGTTGGG
GGA
TGCGATGCATCAATATTGCTCAACCATCCAGGAAGTGAGAGGACTGCATTAGAGAGCAGAACCCTGAGAGGCTTCCAATTGATTGATAATATCAAGATTGAGTTAGAAAAAAGGTGTCCA
AGAATAGTCTCTTGTGCTGACATTCTCACTGCTGCAGCAAGAGATGCCACTCTTATGGCTGGAGGACCATTCTGGGAAGTCCCATTTGGCAGAAAAGATAACAAAATTTCCTTAGCCAGA
GAGGCCAATATGGTTCCTCATGGCCATGAAAACATCACAGCCCTTATTGCATTCTTTCAAGAAAAAGGGTTAGACATTCTTGACTTGGTCACTCTCTCGAGCTCACACACAATTGGGAGG
AGCATTTGCTCTTCTATCATGGATAAGATTTACAACTTCAATCGGACTGGAAAGCCTGACCCTTCGCTCAATGTCTATTTCTTGAAGTTGTTGAGGAAAAGGTGCAAAAGGGTGATGGAT
TTGGTGCACCTTGATGTCATAACCCCTAGGACTTTTGACACAACCTATTACACTAACCTTATGAGGAAAGTGGGGTTGTTGTCAACAGATCAGTCACTGTTTTCAGATGCAAGGACGGCT
CCTTTTGTTGAAGCATTTGCAACATAGCCTTTCCTTTTTACTAGCCAGTTTTCAGTGTCAATGGTGAAGCTAGGGAATGTTCATGTTCTGACTAGGCCTAATGAAGGTGAAATCAGAGTT
AATTGCAATTATGTCAATATTGTC

Retrieve as FASTA