Entry information : GmPrx[P]304 (Glyma18g19030.1)
Entry ID 9048
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-12-02 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]304 (Glyma18g19030.1)
Name (synonym) GmPrx[P]304 (Glyma18g19030.1)
Class Class III peroxidase     [Orthogroup: Prx003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]304
start..stop
S start..stop
GmPrx12 243 2e-82 3..133 1..131
GmPrx86 239 8e-81 1..133 1..133
GmPrx11 239 1e-80 1..133 1..133
GmPrx55 236 2e-79 1..133 1..133
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20720586..20720795 210 N° 2 20720896..20721083 188  
join(20720586..20720795,20720896..20721083)


exon

Literature and cross-references GmPrx[P]304 (Glyma18g19030.1)
DNA ref. Phytozome 12:   Gm18 (20720586..20721083)
Protein sequence: GmPrx[P]304 (Glyma18g19030.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   132 (109)
PWM (Da):   %s   14402.52 (11849.2)  
PI (pH):   %s   7.92 (7.03) Peptide Signal:   %s   cut: 24 range:24-132
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IKMGNNLRFLSLCLLAWIASTHAQLQLGFYANNCPKAEQIVLKFVHDHIHNASSLPTALIRMHFHDCFVRG*DASVLLNLTTNQAERNAPPNLIVRGFDFIDRIKSLVEAECPGVVFCAxILTLAARDTIVAT

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (5' and 3' end are missing and Stop in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCAAAATGGGAAACAACTTGAGGTTTTTGAGTCTTTGCCTCTTGGCATGGATTGCATCAACTCATGCTCAACTTCAGCTTGGTTTTTATGCTAATAATTGCCCAAAAGCAGAGCAAATT
GTTTTGAAATTTGTTCATGACCATATCCATAATGCTTCATCACTACCAACTGCATTAATAAGAATGCACTTTCATGACTGTTTTGTAAGG
GTACGTGCTTCAATCTTTAAGCTTCTGCCA
TTTTTACTTAACAAATACAATGTTATTGTTAGATTAAGGTTAAGGAGCTAACTAAGATGAAGCATTTCAGGGATGAGATGCATCAGTCCTTCTGAACTTAACAACCAATCAGGCTGAGAG
GAATGCTCCTCCAAATCTCATAGTAAGAGGCTTTGACTTCATTGACAGAATAAAGAGCCTAGTTGAAGCTGAATGCCCTGGTGTGGTCTTTTGTGCTGANATCCTCACTTTGGCTGCCAG
AGACACTATTGTAGCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCAAAATGGGAAACAACTTGAGGTTTTTGAGTCTTTGCCTCTTGGCATGGATTGCATCAACTCATGCTCAACTTCAGCTTGGTTTTTATGCTAATAATTGCCCAAAAGCAGAGCAAATT
GTTTTGAAATTTGTTCATGACCATATCCATAATGCTTCATCACTACCAACTGCATTAATAAGAATGCACTTTCATGACTGTTTTGTAAGG
GGATGAGATGCATCAGTCCTTCTGAACTTA
ACAACCAATCAGGCTGAGAGGAATGCTCCTCCAAATCTCATAGTAAGAGGCTTTGACTTCATTGACAGAATAAAGAGCCTAGTTGAAGCTGAATGCCCTGGTGTGGTCTTTTGTGCTGAN
ATCCTCACTTTGGCTGCCAGAGACACTATTGTAGCAAC

Retrieve as FASTA