Entry information : GmPrx[P]313 (Glyma20g04430.1)
Entry ID 9049
Creation 2011-07-04 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx[P]313 (Glyma20g04430.1)
Name (synonym) GmPrx[P]313 (Glyma20g04430.1)
Class Class III peroxidase     [Orthogroup: Prx041]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]313
start..stop
S start..stop
GmPrx105 468 7.18e-169 1..241 85..333
MtPrx90 415 4.23e-148 1..241 85..333
PpePrx23 359 4.41e-126 1..241 85..334
GmPrx[P]246 348 1.74e-123 1..235 9..226
Gene structure Fichier Exons


exon

Literature and cross-references GmPrx[P]313 (Glyma20g04430.1)
DNA ref. Phytozome 12:   Gm20 (4590613..4591742)
Protein sequence: GmPrx[P]313 (Glyma20g04430.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   240 (292)
PWM (Da):   %s   27099.89 (32093.3)  
PI (pH):   %s   7.46 (8.88) Peptide Signal:   %s   cut: 25 range:25-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSEKLAGPNLNSLCGFEVIDKIKYLVKEECPITVSCVDILAMAARDVVELRGGPRWDALLGRKDALESSFSGANILIPAPNSSLEVLIDNFKQQGLDIEDLVTLSGSHTIGRARCLSFR
QRIYNAKEEYHYGYDHYKRYTSFRRILRSICPVEGRDTKFAPLDFQTPKRFHNHYFINILEGKGLLGSDNVLISHDLDGKTTEQVWAYASNEKLLIKMGNINVLTGNEGEIRRNCRFVDA
*

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (first exon is missing and not found). No EST.
DNA
Send to BLAST
CDS
Send to BLAST