Entry information : MeAPx08 (cassava4.1_013189m)
Entry ID 9055
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang LI)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MeAPx08 (cassava4.1_013189m)
Name (synonym) MeAPx08 (cassava4.1_013189m)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeAPx08
start..stop
S start..stop
RcAPx02 511 0 1..287 1..287
HaAPx03 503 0 1..286 1..283
LsaAPx02 501 0 1..286 1..283
CsAPx03 500 0 1..287 1..286
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 276776..276888 113 N° 2 276969..277093 125 N° 3 277198..277247 50 N° 4 277984..278049 66
N° 5 278126..278174 49 N° 6 280833..280915 83 N° 7 280999..281078 80 N° 8 281173..281275 103
N° 9 281652..281846 195  
join(276776..276888,276969..277093,277198..277247,277984..278049,278126..278174, 280833..280915,280999..281078,281173..281275,281652..281846)


exon

Literature and cross-references MeAPx08 (cassava4.1_013189m)
DNA ref. Phytozome 12:   scaffold01481 (276776..281846)
Protein sequence: MeAPx08 (cassava4.1_013189m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288
PWM (Da):   %s   31481.37 Transmb domain:   %s   o259-281i
PI (pH):   %s   7.68
Sequence 329
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALPVVDTEYLKDIDKARRNLRALIAYKNCAPIMLRLAWHDAGTYDKNTKTGGPNGSIRNEEEYTHGANSGLKIALDFCEEVKAKHPNITYADLYQLAGVVAVEVTGGPSIDFVPGRKDSKVSPKEGRLPDAKKGPPHLRDIFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTTEPLKFDNSYFVELLRGETEGLLKLPTDIALVEDPQFRPYVELYAKDEDAFFRDYAVSHKKLSELGFAGSSSGSKAIVKNSTVLAQSAVGVVVAAAVVIVSYLYEVRKKLN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTTACCGGTGGTTGATACAGAGTACCTGAAGGATATCGACAAGGCTCGTCGCAATCTTCGTGCTCTCATTGCCTACAAGAACTGCGCTCCCATCATGCTCCGCTTAGCGTAACCAT
CATCTCTCTCACATCATTTGTTTTCCCCTGCTTTTGTTGATTGATTAATTGAGTGGCTGTTCGTTTGTGAAGGTGGCACGATGCAGGGACTTATGATAAGAACACAAAAACTGGTGGGCC
TAATGGCTCCATAAGGAATGAAGAGGAATACACTCATGGTGCCAATAGTGGGTTGAAGATTGCACTTGATTTTTGTG
GTCAGCTTCTTTATTTTCCTTTCTACCCCTAGTTTTATACTTC
TGTTTGTGTGTGTTTGACTATGTGCGTACGAGTACTTAAATGGGTTGTTTTCATTTTCCAGAAGAAGTGAAAGCTAAACATCCCAACATTACTTATGCTGACTTATACCAGGTGATTATA
TATGGACTTTTTGTAAGGGTTTTATTCGTGGATTGTTTTTCTTTTTATTGTTTATTTCTTCTAGTTACATCCACATATTTAATTGAATCTTAAGTGGGATTTTTTCTTTTTCCATTTTCA
ATTCTTCCTACCAATCATACCTTTACGGGGAGGGAAAGAAAAGGAGGGAATATGCTTGTTAATTCATTAAAAAGAAAAAGAAAACAAGGAAATTCCAATACTTTTTTTTTTTTGAATAAA
GGAAATTCCACTTCTTAATTATGTTTCAAAGTTGATTCTAGTGTACCGTCTTCTGCTGTTTTAACTTTGAGGCTTATGTCAAAACTGATAGAGCATTAGGTGGATGTCTAATTATGCAAA
GAGTAACTTGGAGAGATATTCTGATATTTACTCAGTTAAATTTAAAAGTTGTTGTATAATAATATGGATTTGGAAACATTTTGATGTGCTGTTATAAGTGCCATTCTGTCTGCCCACCAA
ATACACTATATTTGCCAGGTCATGGATAGAGCACGACTCCATGTTGGTTAGATTAGTGCATCAAGGATCAAGCTTAAATATCAGAATTGATAGGATTCTCCCCGAGGTTGTACTTGAGAG
AGAAAGACTATCTTGTTAATATTTAAGTGATAGTTGTTAATATTAGTGGCTCAAATACACAAGAATTGACATTGGTTTTGCAAATATGAGGAGCAAACTGACTTGTATAAATTATTTTCA
TTTTTAGCTCGCTGGTGTCGTTGCAGTTGAGGTCACTGGAGGCCCATCCATTGATTTTGTTCCCGGCAGAAAGGTTTGTGATTGTGCAGTTTCTTGAATTTATGGCTAATTTTCAAAATA
TATTATCATAACTAGTTACCTTCTTTTAGGATTCAAAAGTTTCTCCCAAGGAAGGGCGACTTCCAGATGCTAAAAAAGGTTGTGCTCCATTCTGTTAATCTCACTTCTTCAATTCATGAA
GCCATGTGCATACTGAACTTTTTGGAGTATAACTTTTAAATTAGTTCAGTGAATGATGATGTTGGAGAACCACAAATAACAGTACTCAAAAGCAAGAATAAATAAACTCTTACATTATAT
TACCAGTTGTCAATATCAATAACAATAAACTCTATTAAGATACCAAGATGACATAAGTTTTCTAGTCTAACAACTGGTCCTACTAGTACTTGGATTGGGAATATCAAATAAGTAAATACT
AACCAGATTCTGATTAGAAATACTAAATCAAATCAAACTTCCTGAAGAAAATCCTACTTCCTAAAGTTATTTTTAAAGTAAATAGACCTAAAATCTCTAATAGAAGGACCTGAATCAGAT
AACTTTTACTACTTGTGAGTTTATCTTTTATGTTGACAATGTGAATGATAGATTTTGACCTTCACTAAAAATGATGTTGAAGAATGATGGGGTAGGTTTCATTGTATTACATGATTAGAA
GATGATAAGTTATTTTATGATGGAAAATAGAAATAATAGACTTGTACACACCTGAAAGAAATTAAAATTGAATGTCTGGTGTAACCGTGAGTTGCATCTTCAAGTTTTGCTTAATTTAAT
TATGGTGAGATCTTACAAATTTAATGGCCATAATTTTCAGTTGTATCGTGATGTGCTTGTTTGGTTGATAACTTGTGAGAAAGAGAGTGTAGGTTATGTATATATTTTTCAGGTTGTTTG
TTTTGCATGTAGTACAATAAGCAATTTGTGATGCTTGCTCCCTTATCTCTTTTGGTAAAAGGCATGATGCGTTGAGGGAGGTAATTTGCATGAACAACCATGTAATCAGTTGATGCACTT
ATAAGTTTACACACTCTGATTTCCTTCCATATGCGAGCAATCATTTTATGTTCAAAGCTCTGCACTTTACTGCTTTAATTTTATGGAAATCATTGTCATTAAATTGCCTTGTGGTTTACT
TTCTCCAACTAGAATGGTTCTGTATAGTGATTGTCACTTGTCNNNNNNNNNNNNNNNNNNNNNNNNGAACCTCAATTTGTTGAATGTGGTGCTTATTTTCTGCATGATTCGGGATATCTT
TTCAGTTTCCTGTGTTTAAAATAGTATTGTAAATTGTAAGTCCTTAACCTGACCTCAACTCTAGGTAGGCTTGCACTTACACCTCTAGAATGCTCAACCAGCATTCTCTTATTATGGTTT
TGACAAATTGTTGCTTCCTTGTATGTTTATTGAAAGTAAATGACTGAGAAAGCTGATGTGCATGCACATAATTAATGGTTTAGCTCAAATTGATAGTTATATTATGTTAATGTAAATTTA
ACAGGCATATGGTGCTACACCTCAAAATCTTGACTTTCATTGGCCTTTTGAAGTTAGGATTACTTAAGTTGCTTTTGTTCCTTCATTCTTGTCAAGAACTTCACCGTTTTACAGTGTCAC
ATTATTTGTTTAAATAATCACAGAGCACTAAAGTTATTTTGTGCAACTTAAGTTGTTGCACAAAGATCTTAATTAAGAGTCAAATTTCTATAAAATTTATTGCCGCGTGAAGAAGTTTGG
CAGAGGTATTTTTTTTGGGATCAGGACATGGAATTAATATAATTGCATTAATTTATTACTATTTGAATATGAATAATGAGGTTTGTTGGCTATGTTGGGAAGCAAATTATGTTTTTAGCC
TACTTCTGGTGAGAGGCAGTGGAGTGTGTGTTTGCACAGTGTTGTCCTAATTGATGCACCAATAAATTGCAGTATCAAAATTATCACCGTAGGAGAGTCATCTACTGTACGTTAAGAAAA
TCACTTGAAACTCTAAGATGAAGGATTCAAATTATGAATGACTCAAGTGTATTAGGTCAGTCACTTGTTTTAACAATTCATGACGCTGCCTAATTCATGAAGCTGCCTTGATTTTCTTTA
TCACTTAGACTAGATAGCACTACAGTTCTTTTTGTTCATTAGGATCCAAAAGTATTCCAAGAGACTTGATATTATGCAAATCATTAGGCAAAGTGCAAGAAAAGCAGATAAAAAGTTTGG
TCTCTCTTATAGGGAACATTAGACACAGACATTGACTGACATATTTGGGGATCTGATATTTGTTCATTTGAAGATTAAACAAGCTAGTTGTTTGTCTGTGCAGTTCTGGATATGGTTTTG
AAAATATTTGTTGGTCATTTATTGAAATTTTCTTGTGTTATAGCTTGTGTAATACTTGTTTGTAGCTTTATTTTTTTGTCACATTGTTATTAGGGAAATGTAGAGCGATAGATGTCTATT
AATTGAATTCATTGAATAGGAAATACCAGGTTGTGATTGGGAAGAGACAAACATATTAAAGTAAGGGGTTTCTATCTTGGAGTTAGGTGTGGCCTTTGGCTGAGGGATTAGGTCATGTGA
AAACTTGGATGAATAATATTTTGGTTGACTGTAGATTAAGATTAAAATGTGGTGGTGAAACTCAAAGTTTCGGAAAGGTCTCGCATTTAAGCAACATTATGCTAATGTTTTTATTTGTTG
ACCTTTCGTAAACAAAGTGTTTTAACAGATCCTTGGCAGAAGTATGTTCATGTTTGTGTTTCTATTTGAATGGTTTCTTTTTGAATTTTGTGGTAGGTCCACCACATTTAAGGGATATCT
TTTATCGGATGGGCCTGTCTGACAAGGATATAGTGGCACTCTCGGGGGGTCATACTCTG
GTAACTCTCTGACTTGTTTTATTCAGTTGCAGTAAGCTGTAAGATGCAAAACTATAATTCT
TTGACTGCTATGCGATATATAGGGAAGGGCGCATCCAGAGAGATCAGGTTTTGATGGCCCTTGGACCACAGAGCCTCTGAAGTTTGATAACTCATATTTTGTGTAAGATTTAAATGAAGA
ATTGAAAATTTTCATACACCTCTTTTTATGCATTGTCTGAATTCAAATAAATCTGTTATTTGTTGTCTGATTCTAGGGAATTGCTGAGAGGGGAGACAGAGGGACTGTTGAAACTCCCAA
CAGACATTGCTCTGGTGGAAGACCCTCAATTTCGTCCTTATGTTGAGCTGTATGCGAAG
GTAATATGGACCCCTCGTCTTACCAGTCAAATGACCATATATTCAGACGTGTACATGTACT
GTTGCCAAATAATCACCTAATATGGACCCCTCTTCTTACCAGTCAAATGACCATATATTCAGACGTGTACATGTACTGTTGCCAAATAATCACCTTTATGGTGACTCTTCTTTGTAGATC
TAATATTTGCATTTGTGGAACTTCATATCATCTCTTCTGAAAAAAAAATCTTGCAAAAAAGAAAAATAAAAAAGAAAGAAGAGTAATCATCATCTAAGCATTTGAAAATATTTGTTTCTG
CAGTTGAAGATAAAGTCATGCTTGGAATAGATAAAATTGGAACGACTCATTGACTGAATAATTGTTGGGTGACAGGATGAGGATGCATTCTTTAGAGACTACGCAGTGTCACATAAGAAA
CTTTCAGAATTAGGATTCGCTGGAAGTTCCTCTGGCTCCAAAGCAATTGTTAAGAACAGCACCGTGCTGGCACAAAGTGCAGTTGGAGTTGTAGTTGCTGCTGCTGTGGTGATTGTTAGC
TATTTATATGAAGTTCGCAAGAAATTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTTACCGGTGGTTGATACAGAGTACCTGAAGGATATCGACAAGGCTCGTCGCAATCTTCGTGCTCTCATTGCCTACAAGAACTGCGCTCCCATCATGCTCCGCTTAGCGTGGCACG
ATGCAGGGACTTATGATAAGAACACAAAAACTGGTGGGCCTAATGGCTCCATAAGGAATGAAGAGGAATACACTCATGGTGCCAATAGTGGGTTGAAGATTGCACTTGATTTTTGTG
AAG
AAGTGAAAGCTAAACATCCCAACATTACTTATGCTGACTTATACCAG
CTCGCTGGTGTCGTTGCAGTTGAGGTCACTGGAGGCCCATCCATTGATTTTGTTCCCGGCAGAAAGGATTCAA
AAGTTTCTCCCAAGGAAGGGCGACTTCCAGATGCTAAAAAAG
GTCCACCACATTTAAGGGATATCTTTTATCGGATGGGCCTGTCTGACAAGGATATAGTGGCACTCTCGGGGGGTCATA
CTCTG
GGAAGGGCGCATCCAGAGAGATCAGGTTTTGATGGCCCTTGGACCACAGAGCCTCTGAAGTTTGATAACTCATATTTTGTGGAATTGCTGAGAGGGGAGACAGAGGGACTGTTGA
AACTCCCAACAGACATTGCTCTGGTGGAAGACCCTCAATTTCGTCCTTATGTTGAGCTGTATGCGAAG
GATGAGGATGCATTCTTTAGAGACTACGCAGTGTCACATAAGAAACTTTCAG
AATTAGGATTCGCTGGAAGTTCCTCTGGCTCCAAAGCAATTGTTAAGAACAGCACCGTGCTGGCACAAAGTGCAGTTGGAGTTGTAGTTGCTGCTGCTGTGGTGATTGTTAGCTATTTAT
ATGAAGTTCGCAAGAAATTGAAT

Retrieve as FASTA