Entry information : MePrx12 (cassava4.1_013283m)
Entry ID 9058
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2015-03-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-16 (Achraf Jemmat)
Peroxidase information: MePrx12 (cassava4.1_013283m)
Name (synonym) MePrx12 (cassava4.1_013283m)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx12
start..stop
S start..stop
MePrx128 613 0 1..340 1..342
PtPrx95 561 0 5..340 4..340
PtPrx92 557 0 5..340 4..341
PpePrx72 528 0 3..340 1..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 794028..794267 240 N° 2 793696..793887 192 N° 3 793432..793597 166 N° 4 792899..793320 422
complement(join(792899..793320,793432..793597,793696..793887,794028..794267))


exon

Literature and cross-references MePrx12 (cassava4.1_013283m)
DNA ref. Phytozome 12:   scaffold08359 (794105..792899)
Protein sequence: MePrx12 (cassava4.1_013283m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   36970.52  
PI (pH):   %s   4.91
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALTPLLHSKLFQVVLLVSVFIFSSGLYASDDSHLSLDYYASTCPTVFDIIRKEMECEVLSDPRNAALVVRLHFHDCFVQGCDGSVLLDDTISLRGEKKSSPNINSLKGFGIIDKIKNKVESECPEIVSCADILTIAARDAVILVGGPYWDVPVGRKDSKTASYELASANIPTADEGLVSIISKFLYQGLSVTDMVALSGAHTIGMARCANFRARIYGDFETASDRSPMSETYLSNLKSICPAAGGGDNNVSAMDNITPNLFDNSYYQILLKGEGLLNSDQELYSSILGIQTKQLVVKYAHDPIGFFQQFSDSMVKLGNITNSDSFANGEVRKNCRFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from Phytozome (large PS is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGACGCCTCTCTTGCACTCTAAGCTTTTCCAGGTTGTTCTTTTGGTTTCTGTCTTCATCTTTAGCAGCGGCTTGTATGCAAGTGATGACTCTCATTTGTCTTTGGATTACTAT
GCATCTACTTGCCCCACTGTCTTCGACATTATCAGGAAAGAAATGGAATGCGAAGTGCTCTCAGATCCACGCAATGCAGCTCTTGTAGTACGACTGCACTTCCATGACTGCTTTGTTCAG
GTCCACTCCCACTTTCTTATAGCATTACTTTCACTTGTGAGCTTTTTTGGCCTGCCCTTGGCCAAATAATGCCATTTTAGGGAGTTCATAGTTTCCTTTTTTTTCTCAGAGCTTCTAAAT
TTATTGTTCAAAGGGTGCAGGGATGCGATGGATCGGTTTTGCTAGACGACACAATCAGTTTGAGAGGAGAGAAGAAATCTTCTCCAAACATAAACTCACTAAAAGGTTTTGGAATCATTG
ATAAGATCAAGAACAAGGTCGAATCTGAGTGCCCTGAAATAGTATCTTGTGCAGATATCCTCACTATTGCTGCAAGAGATGCAGTGATTCTG
GTACTGTATAATACAATGGCGTTCCAAG
TAAAATATTTTCATTTTTCGCTTGTTCTAAGAATCTTGAAGACTTCTTTGTTCCTGTCAAATGCTGCCAGGTCGGTGGACCATATTGGGATGTTCCCGTGGGAAGGAAAGATTCCAAGAC
TGCAAGCTATGAGCTTGCGTCAGCAAATATTCCAACTGCAGATGAAGGTCTTGTATCTATCATTTCCAAGTTTCTTTATCAGGGCCTGTCTGTTACAGATATGGTAGCCCTGTCAG
GTAA
AATCTCTTACAGGGACAGTCAACCTGTCCAGACTCCGGAACTGCTACTTTAAATTTGCATATTCATATCATTAAAAACTTCAGACGACGGATTTGCATAATCTGCAGGGGCACACACCAT
AGGCATGGCTCGGTGTGCGAATTTTCGAGCAAGGATTTATGGAGATTTTGAAACAGCTTCAGACAGGAGTCCAATGTCAGAGACATATCTGAGTAACCTGAAATCTATATGTCCAGCTGC
TGGAGGTGGAGACAATAACGTTTCAGCAATGGACAATATCACTCCTAATCTTTTCGACAACTCATACTATCAGATTCTATTGAAAGGAGAAGGACTACTGAATTCAGACCAAGAATTGTA
CTCCAGCATTCTTGGAATTCAGACAAAGCAGCTTGTTGTGAAGTATGCTCATGACCCAATAGGTTTCTTCCAGCAATTCTCTGATTCTATGGTGAAATTGGGAAATATTACCAATTCTGA
TAGCTTTGCCAATGGAGAAGTCAGGAAGAACTGCAGATTTGTGAACACA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGACGCCTCTCTTGCACTCTAAGCTTTTCCAGGTTGTTCTTTTGGTTTCTGTCTTCATCTTTAGCAGCGGCTTGTATGCAAGTGATGACTCTCATTTGTCTTTGGATTACTAT
GCATCTACTTGCCCCACTGTCTTCGACATTATCAGGAAAGAAATGGAATGCGAAGTGCTCTCAGATCCACGCAATGCAGCTCTTGTAGTACGACTGCACTTCCATGACTGCTTTGTTCAG
GGATGCGATGGATCGGTTTTGCTAGACGACACAATCAGTTTGAGAGGAGAGAAGAAATCTTCTCCAAACATAAACTCACTAAAAGGTTTTGGAATCATTGATAAGATCAAGAACAAGGTC
GAATCTGAGTGCCCTGAAATAGTATCTTGTGCAGATATCCTCACTATTGCTGCAAGAGATGCAGTGATTCTG
GTCGGTGGACCATATTGGGATGTTCCCGTGGGAAGGAAAGATTCCAAG
ACTGCAAGCTATGAGCTTGCGTCAGCAAATATTCCAACTGCAGATGAAGGTCTTGTATCTATCATTTCCAAGTTTCTTTATCAGGGCCTGTCTGTTACAGATATGGTAGCCCTGTCAG
GG
GCACACACCATAGGCATGGCTCGGTGTGCGAATTTTCGAGCAAGGATTTATGGAGATTTTGAAACAGCTTCAGACAGGAGTCCAATGTCAGAGACATATCTGAGTAACCTGAAATCTATA
TGTCCAGCTGCTGGAGGTGGAGACAATAACGTTTCAGCAATGGACAATATCACTCCTAATCTTTTCGACAACTCATACTATCAGATTCTATTGAAAGGAGAAGGACTACTGAATTCAGAC
CAAGAATTGTACTCCAGCATTCTTGGAATTCAGACAAAGCAGCTTGTTGTGAAGTATGCTCATGACCCAATAGGTTTCTTCCAGCAATTCTCTGATTCTATGGTGAAATTGGGAAATATT
ACCAATTCTGATAGCTTTGCCAATGGAGAAGTCAGGAAGAACTGCAGATTTGTGAACACA

Retrieve as FASTA