Entry information : MePrx100 (cassava4.1_027775m)
Entry ID 9061
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-25 (Christophe Dunand)
Peroxidase information: MePrx100 (cassava4.1_027775m)
Name (synonym) MePrx100 (cassava4.1_027775m)
Class Class III peroxidase    [Orthogroup: Prx189]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx100
start..stop
S start..stop
MePrx13 577 0 1..352 1..352
MePrx125 536 0 1..351 1..351
MePrx137 466 4e-166 30..350 31..351
MePrx09 395 3e-138 1..352 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 858688..858942 255 N° 2 859037..859219 183 N° 3 859298..859915 618  
join(858688..858942,859037..859219,859298..859915)


exon

Literature and cross-references MePrx100 (cassava4.1_027775m)
DNA ref. Phytozome 12:   scaffold06814 (858688..859915)
Protein sequence: MePrx100 (cassava4.1_027775m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (325)
PWM (Da):   %s   39382.01 (36526.5)  
PI (pH):   %s   7.34 (6.66) Peptide Signal:   %s   cut: 28 range:28-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKVKSFTPLLFISFLLLASCLSSSNGELFKPNVTIANGLEFGYYRFTCPQVDTLVRNYLTQVYRADPGQAAAILRLQSHDCFVQGCDGSVLLDRSPERSEIPNKHFKQQTFQIIETLRQIVHTHCGRVVSCSDLLTLAARDAVFLTGGPDFTVPLGRRDGVTFPRVNQTFEDLIAPTAKTTEILTKFARKGLNLLDTVALSGAHTIGIARCSSFRERLFPTRDPTMEISLYEKLRPYCAFPEFDSLTWLDFRSPFKFDNLYFVDLINRQGLFTSDQDLFEDPRTRGTVINFANNEFQFFASFAGALIKMGTVGVLTDGQGEIRARCNMRNSDFFNLESVLEKDKNSSSAAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAAGTTAAATCTTTCACTCCTCTCCTTTTTATTTCTTTTCTCCTGCTGGCTTCTTGCCTTAGCAGTTCTAATGGGGAACTATTCAAACCTAATGTTACTATAGCTAATGGTCTG
GAGTTTGGATATTACAGATTCACATGTCCTCAGGTTGACACTCTTGTGAGAAATTATCTGACGCAAGTTTACAGAGCGGACCCAGGGCAAGCAGCTGCAATACTTCGTCTCCAATCCCAT
GACTGCTTTGTTCAG
GTCGTTTTCTGTGATCTCTAGCTTTCTGAAATGGGATATGTAAGCTTATATTTATTGTATTATTGAATCTGGATGTGCATGAAAAATTAAACAGGGATGCGATGG
ATCGGTATTGCTTGATAGATCACCCGAGAGGAGTGAGATTCCCAACAAGCACTTCAAACAACAGACATTTCAGATCATAGAAACTCTCCGCCAAATTGTCCACACTCACTGCGGCCGTGT
CGTCTCTTGTTCTGATCTTCTCACACTCGCTGCTCGTGATGCCGTCTTCCTT
GTAAGTTGCAACTCATTACTCTCATTGTGGCCGTGTCGTCTCTTTCATTACAAGTGATTATTATTGTT
GTTATTACAGACAGGTGGGCCTGACTTTACAGTCCCTTTAGGAAGGCGAGATGGGGTAACATTCCCAAGAGTAAACCAAACATTTGAAGACCTGATAGCTCCTACTGCTAAAACAACTGA
AATACTAACGAAGTTTGCTCGAAAAGGCTTGAATCTTCTCGACACTGTAGCCCTCTCAGGTGCCCACACCATCGGCATCGCCCGTTGCAGCTCATTCCGAGAACGTCTATTTCCTACCAG
AGATCCTACCATGGAAATTTCCTTATACGAGAAACTTAGGCCTTATTGTGCTTTTCCAGAATTCGACTCTCTAACTTGGTTGGATTTTCGATCCCCTTTCAAATTCGACAACCTGTACTT
CGTCGATCTCATAAACCGACAGGGCTTATTTACTTCAGACCAAGATTTGTTTGAAGATCCAAGGACTAGAGGAACTGTTATTAATTTTGCTAATAACGAATTTCAGTTCTTCGCTAGCTT
CGCGGGTGCATTGATCAAAATGGGGACTGTGGGAGTGTTGACAGATGGACAAGGGGAAATTCGTGCCAGATGTAACATGAGGAATTCTGATTTCTTCAATTTGGAATCTGTATTAGAAAA
AGATAAGAATTCATCCTCTGCAGCTATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAAGTTAAATCTTTCACTCCTCTCCTTTTTATTTCTTTTCTCCTGCTGGCTTCTTGCCTTAGCAGTTCTAATGGGGAACTATTCAAACCTAATGTTACTATAGCTAATGGTCTG
GAGTTTGGATATTACAGATTCACATGTCCTCAGGTTGACACTCTTGTGAGAAATTATCTGACGCAAGTTTACAGAGCGGACCCAGGGCAAGCAGCTGCAATACTTCGTCTCCAATCCCAT
GACTGCTTTGTTCAG
GGATGCGATGGATCGGTATTGCTTGATAGATCACCCGAGAGGAGTGAGATTCCCAACAAGCACTTCAAACAACAGACATTTCAGATCATAGAAACTCTCCGCCAA
ATTGTCCACACTCACTGCGGCCGTGTCGTCTCTTGTTCTGATCTTCTCACACTCGCTGCTCGTGATGCCGTCTTCCTT
ACAGGTGGGCCTGACTTTACAGTCCCTTTAGGAAGGCGAGAT
GGGGTAACATTCCCAAGAGTAAACCAAACATTTGAAGACCTGATAGCTCCTACTGCTAAAACAACTGAAATACTAACGAAGTTTGCTCGAAAAGGCTTGAATCTTCTCGACACTGTAGCC
CTCTCAGGTGCCCACACCATCGGCATCGCCCGTTGCAGCTCATTCCGAGAACGTCTATTTCCTACCAGAGATCCTACCATGGAAATTTCCTTATACGAGAAACTTAGGCCTTATTGTGCT
TTTCCAGAATTCGACTCTCTAACTTGGTTGGATTTTCGATCCCCTTTCAAATTCGACAACCTGTACTTCGTCGATCTCATAAACCGACAGGGCTTATTTACTTCAGACCAAGATTTGTTT
GAAGATCCAAGGACTAGAGGAACTGTTATTAATTTTGCTAATAACGAATTTCAGTTCTTCGCTAGCTTCGCGGGTGCATTGATCAAAATGGGGACTGTGGGAGTGTTGACAGATGGACAA
GGGGAAATTCGTGCCAGATGTAACATGAGGAATTCTGATTTCTTCAATTTGGAATCTGTATTAGAAAAAGATAAGAATTCATCCTCTGCAGCTATT

Retrieve as FASTA