Entry information : MePrx109 (cassava4.1_029336m)
Entry ID 9068
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-06 (Christophe Dunand)
Peroxidase information: MePrx109 (cassava4.1_029336m)
Name (synonym) MePrx109 (cassava4.1_029336m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx109
start..stop
S start..stop
RcPrx77 545 0 1..321 1..323
RcPrx85 496 9.62e-179 1..321 1..320
PtPrx24 495 1.35e-178 1..321 1..322
PtPrx23 492 3.44e-177 1..321 1..322
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9068' 'complement(join(182871..183259,183347..183512,183612..183803,183938..184156))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 183938..184156 217 N° 2 183612..183803 190 N° 3 183347..183512 164 N° 4 182871..183259 387
complement(join(182871..183259,183347..183512,183612..183803,183938..184156))


exon

Literature and cross-references MePrx109 (cassava4.1_029336m)
DNA ref. Phytozome 12:   scaffold07035 (184156..182871)
Protein sequence: MePrx109 (cassava4.1_029336m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   34601.03 (31725.6)  
PI (pH):   %s   5.19 (5.02) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSRFSFTFMVLTIVLMVLSCLPCQAQLSSNFYDDTCPNALSTIR
TVIRSAVSRERRMAASLVRLQFHDCFVQ
GCDGSILLDDTPSMAGEKFARNNNQSVRGFEVIDDAKAEVESICPGVVSCADIVAIAARDASVAVGGPSWTVKLGRRDSTSASRAEANRNLPGFSDSLESLISSFEGKGLSERDLVALSG
SHTIGQASCLTFRDRIYDNASDIDAGFASTRRRQCPATGGDRNLAPLDLVTPNSFDNNYFKNLLQKKGLLQSDQVLFSGGSTDSIVDEYSRSPSAFNSDFASAMVKMGDIDPKTGSQGEI
RRLCNVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCTCGTTTTTCTTTCACTTTCATGGTTTTGACGATAGTCTTAATGGTTCTTTCATGCTTGCCATGTCAAGCACAGCTTTCTTCAAATTTCTATGACGACACATGTCCTAATGCA
TTGAGTACTATTCGCACGGTTATTAGATCGGCTGTCTCGCGAGAGCGTAGAATGGCAGCATCTCTCGTTCGCCTTCAGTTCCATGATTGCTTTGTTCAG
GTAAATTGAAAATTTTAACTA
TAGCAACGCATCTCCTTTTTTTATATTATTGCATTTATATGAAGAATTAATATAGTAATACATTAGGACATAAAATTGGCTTAGAGTTGCTAATGACTTTGTAAATATTGCAGGGGGGTG
TGATGGTTCAATCTTGCTGGATGATACGCCTTCAATGGCTGGAGAGAAATTTGCACGCAACAACAACCAGTCTGTTAGAGGATTCGAAGTCATAGATGACGCCAAGGCTGAAGTTGAGAG
CATATGCCCTGGAGTCGTTTCATGCGCTGATATTGTGGCAATAGCTGCCCGTGATGCTTCTGTTGCT
GTGAGTAATTATATTATATAAATATCCTCATTAATTTGCTTTAATTTTTATTA
CCATCACGTTCGTTAATATAAGGTTTCTCTATGTATAAAAAAATAGGTGTTGGTGGACCGTCATGGACAGTGAAGCTGGGAAGGAGAGACTCTACCTCTGCAAGCCGAGCCGAAGCCAAT
CGCAACCTTCCAGGTTTTAGTGATAGCCTTGAAAGTCTCATCTCTTCGTTTGAAGGGAAAGGTTTAAGTGAAAGAGACTTGGTTGCTCTTTCAG
GTATATATCCTATACTTTCAGAAATT
ATAATTAATTAATACGTTAGATTTGTTCATCAAGATGGCTAAACAATTCTGTGGGATACAGGAGATCACATACAATAGGCCAAGCGAGTTGCCTGACCTTCCGTGACAGGATCTACGACA
ATGCAAGTGATATCGATGCTGGTTTTGCAAGCACACGGAGGCGCCAGTGTCCGGCCACTGGTGGGGATAGGAATCTTGCACCACTGGATTTGGTGACGCCAAATTCTTTTGATAACAACT
ACTTCAAGAACCTTCTTCAAAAAAAGGGACTTCTTCAATCAGATCAGGTGCTTTTTAGCGGTGGATCAACAGACAGCATTGTTGATGAGTACAGCCGCAGCCCTTCAGCTTTCAATTCTG
ATTTTGCTTCTGCCATGGTAAAGATGGGAGATATAGATCCAAAAACTGGTTCTCAAGGAGAGATTCGCAGGCTTTGCAATGTTGTTAATAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCTCGTTTTTCTTTCACTTTCATGGTTTTGACGATAGTCTTAATGGTTCTTTCATGCTTGCCATGTCAAGCACAGCTTTCTTCAAATTTCTATGACGACACATGTCCTAATGCA
TTGAGTACTATTCGCACGGTTATTAGATCGGCTGTCTCGCGAGAGCGTAGAATGGCAGCATCTCTCGTTCGCCTTCAGTTCCATGATTGCTTTGTTCAG
GGGTGTGATGGTTCAATCTTG
CTGGATGATACGCCTTCAATGGCTGGAGAGAAATTTGCACGCAACAACAACCAGTCTGTTAGAGGATTCGAAGTCATAGATGACGCCAAGGCTGAAGTTGAGAGCATATGCCCTGGAGTC
GTTTCATGCGCTGATATTGTGGCAATAGCTGCCCGTGATGCTTCTGTTGCT
GTTGGTGGACCGTCATGGACAGTGAAGCTGGGAAGGAGAGACTCTACCTCTGCAAGCCGAGCCGAAGCC
AATCGCAACCTTCCAGGTTTTAGTGATAGCCTTGAAAGTCTCATCTCTTCGTTTGAAGGGAAAGGTTTAAGTGAAAGAGACTTGGTTGCTCTTTCAG
GATCACATACAATAGGCCAAGCG
AGTTGCCTGACCTTCCGTGACAGGATCTACGACAATGCAAGTGATATCGATGCTGGTTTTGCAAGCACACGGAGGCGCCAGTGTCCGGCCACTGGTGGGGATAGGAATCTTGCACCACTG
GATTTGGTGACGCCAAATTCTTTTGATAACAACTACTTCAAGAACCTTCTTCAAAAAAAGGGACTTCTTCAATCAGATCAGGTGCTTTTTAGCGGTGGATCAACAGACAGCATTGTTGAT
GAGTACAGCCGCAGCCCTTCAGCTTTCAATTCTGATTTTGCTTCTGCCATGGTAAAGATGGGAGATATAGATCCAAAAACTGGTTCTCAAGGAGAGATTCGCAGGCTTTGCAATGTTGTT
AATAAT

Retrieve as FASTA