Entry information : MePrx112 (cassava4.1_029449m)
Entry ID 9070
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang LI)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx112 (cassava4.1_029449m)
Name (synonym) MePrx112 (cassava4.1_029449m)
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx112
start..stop
S start..stop
RcPrx09 328 7e-115 2..191 4..192
PpePrx26 313 7e-109 7..190 8..191
PtPrx78 311 2e-108 1..190 4..191
CclPrx45 302 2e-104 4..190 5..192
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 208468..208665 198 N° 2 208755..208934 180 N° 3 209017..209214 198  
join(208468..208665,208755..208934,209017..209214)


exon

Literature and cross-references MePrx112 (cassava4.1_029449m)
DNA ref. Phytozome 12:   scaffold07478 (208468..209214)
Protein sequence: MePrx112 (cassava4.1_029449m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   192 (173)
PWM (Da):   %s   20427.39 (18215.2)  
PI (pH):   %s   6.5 (6.50) Peptide Signal:   %s   cut: 20 range:20-192
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWWQLVFLVIFVVGLPVQGQLRNGFYASSCPNAENIVRSTVESHFQKDPAIAAGLLRLHFHDCFVQGCDGSILITGSSAERSALPNLGLRGFEVIDDAKSQLEASCPGVVSCADILALAARDAVDLSDGPSWAVPTGRKDGRVSSSSQASNLPSPLDSIAAQKQKFAAKGLDDRDLVTLVGMHKIRPFPCFD

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to NNNNNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGTGGCAGCTGGTTTTTCTGGTGATTTTCGTGGTGGGTTTGCCTGTTCAAGGCCAGTTGAGAAATGGGTTTTATGCCTCTTCTTGTCCAAATGCTGAGAACATAGTCAGATCAACT
GTTGAATCACACTTCCAAAAGGATCCAGCCATTGCTGCTGGATTGCTCAGGCTCCATTTCCATGACTGCTTTGTTCAG
GTTGCCTGCCTTTCTTTCTCCTTTTTGGCTTCTTATCATGTT
CAATGAGTAGTGTCATGAGTAACTAAAATATGCAAGTGTTTTCACAGGGCTGTGATGGCTCAATATTAATTACAGGGTCTTCTGCTGAGAGAAGTGCATTGCCAAACTTAGGATTAAGAG
GATTTGAAGTGATTGACGATGCTAAATCACAGTTAGAGGCCTCGTGCCCTGGTGTGGTCTCTTGTGCTGACATATTGGCACTGGCTGCTCGTGATGCTGTGGACTTG
GTACGCCACCTCT
TCTCTCTGCCNNNNNNNNNNNNNNNNNNNNNNNGGTGTTTGTTTAATAGGATTGATTGCCATGTTTCAGAGTGATGGACCGAGTTGGGCAGTCCCAACTGGGAGGAAAGATGGCAGAGTC
TCATCGTCGTCCCAAGCATCGAATTTGCCTTCGCCTCTTGATTCCATCGCTGCCCAGAAGCAAAAATTTGCAGCTAAAGGCCTTGATGATCGTGACCTCGTTACCTTAGTAGGTATGCAT
AAGATCCGTCCCTTCCCTTGCTTCGAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGTGGCAGCTGGTTTTTCTGGTGATTTTCGTGGTGGGTTTGCCTGTTCAAGGCCAGTTGAGAAATGGGTTTTATGCCTCTTCTTGTCCAAATGCTGAGAACATAGTCAGATCAACT
GTTGAATCACACTTCCAAAAGGATCCAGCCATTGCTGCTGGATTGCTCAGGCTCCATTTCCATGACTGCTTTGTTCAG
GGCTGTGATGGCTCAATATTAATTACAGGGTCTTCTGCTGAG
AGAAGTGCATTGCCAAACTTAGGATTAAGAGGATTTGAAGTGATTGACGATGCTAAATCACAGTTAGAGGCCTCGTGCCCTGGTGTGGTCTCTTGTGCTGACATATTGGCACTGGCTGCT
CGTGATGCTGTGGACTTG
AGTGATGGACCGAGTTGGGCAGTCCCAACTGGGAGGAAAGATGGCAGAGTCTCATCGTCGTCCCAAGCATCGAATTTGCCTTCGCCTCTTGATTCCATCGCT
GCCCAGAAGCAAAAATTTGCAGCTAAAGGCCTTGATGATCGTGACCTCGTTACCTTAGTAGGTATGCATAAGATCCGTCCCTTCCCTTGCTTCGAT

Retrieve as FASTA