Entry information : MePrx120 ( cassava4.1_030389m)
Entry ID 9078
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-03 (Christophe Dunand)
Peroxidase information: MePrx120 ( cassava4.1_030389m)
Name (synonym) MePrx120 ( cassava4.1_030389m)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx120
start..stop
S start..stop
PnPrx90 513 0 12..331 10..329
PtPrx90 509 0 5..331 4..330
CclPrx110 504 0 13..330 13..328
CsPrx21 500 2.91e-180 13..330 13..328
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9078' 'join(406463..406684,406810..407001,407080..407245,407389..407801)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 406463..406684 220 N° 2 406810..407001 190 N° 3 407080..407245 164 N° 4 407389..407801 411
join(406463..406684,406810..407001,407080..407245,407389..407801)


exon

Literature and cross-references MePrx120 ( cassava4.1_030389m)
DNA ref. Phytozome 12:   scaffold04019 (406463..407801)
Protein sequence: MePrx120 ( cassava4.1_030389m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (304)
PWM (Da):   %s   35380.5 (32486.0)  
PI (pH):   %s   5.68 (5.37) Peptide Signal:   %s   cut: 28 range:28-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTHPKNLADQLCVVLAITFLCQVGVLSQLEVGFYTNSCGLAEFIV
KDEVRAAFAKDKGVAAGLVRMHFHDCFVR
GCDASVLIDSTPSNTAEKDSAVNNPSLRGFEVIDKAKSRLEALCEGIVSCADVLAFAARDSVELTGGLGYDVPAGRRDGKISLASETLTNLPGPTFNVNQLTQSFADKGLSQDEMVTLSG
AHTIGRSHCTSFSNRLYKFNGTNSQDPSLDGTYAARLKQQCPQGNTDPSLVVPMDPSSPSTTDVGYYIDVQANRGLFTSDQTLMTNPATANQVNLNARNVNLWRSKFATAMVKMGQIDVL
TGADSGEIRTNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCATCCAAAGAATCTAGCTGATCAACTATGTGTAGTTTTAGCGATTACTTTTTTGTGTCAAGTTGGTGTTCTTTCTCAGCTTGAAGTTGGTTTTTATACTAACTCATGTGGTTTA
GCTGAGTTCATTGTGAAAGACGAGGTTAGGGCTGCTTTCGCTAAGGATAAAGGAGTCGCTGCTGGTCTTGTAAGAATGCACTTTCACGATTGCTTTGTTAGG
GGGTAAGAACTACATATG
TTGATAGCTACCGAGGATGTTTTCTTTTTTAAGCTACATGGAAAGTTCTTAAATGAGATTGAATTTCTGTAAGAGATAATGACAATTAAACACTCATTATTACATATAGGGGTGTGACGC
TTCTGTTCTTATTGACTCCACACCCTCAAACACAGCAGAGAAAGACTCGGCAGTCAATAACCCAAGCCTGAGGGGATTTGAAGTCATTGACAAAGCAAAGTCTAGACTAGAAGCTCTTTG
TGAAGGAATTGTTTCCTGTGCTGATGTACTCGCATTTGCAGCAAGAGATAGCGTTGAGTTA
TAGTAAGTATATAATATTACCATTGACTAAATCATAACAAATCAAAATTATTACATATA
GTATTATTATTATTTGTGCAGACTGGAGGGCTTGGCTATGATGTTCCTGCAGGAAGAAGAGATGGCAAAATTTCATTAGCCTCAGAAACTTTAACAAACTTACCTGGTCCAACATTCAAT
GTCAACCAGCTTACTCAATCATTTGCAGACAAGGGTTTGTCGCAAGATGAAATGGTTACACTTTCTG
TGGTATTATTATTACTATTTCTACCTAGATATATACTACAACTTTTCTTTTAA
AACAATTCAGATTAATCAACAACTAGCAGCTGGAAGTTGTTATTTTCATATCAAACAGTATGTAAGATAATACATGTGCATGAATTATGCAGGAGCACACACCATAGGTCGTTCCCACTG
CACTTCCTTCAGTAACAGATTATACAAATTCAATGGAACAAATAGCCAGGATCCAAGCTTAGATGGAACGTATGCAGCCAGGTTGAAGCAGCAGTGCCCACAAGGGAACACTGATCCTAG
CTTGGTGGTGCCAATGGACCCTTCTAGTCCAAGCACAACAGACGTAGGTTATTACATAGATGTCCAAGCAAACCGAGGGTTGTTCACTTCAGACCAGACTCTCATGACAAACCCAGCAAC
AGCAAACCAAGTGAATCTAAATGCAAGAAATGTCAATCTTTGGAGAAGTAAATTTGCTACAGCCATGGTGAAGATGGGTCAAATTGATGTTTTGACAGGTGCAGATTCTGGAGAGATTCG
AACAAACTGTAGGGTCGTCAACACC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCATCCAAAGAATCTAGCTGATCAACTATGTGTAGTTTTAGCGATTACTTTTTTGTGTCAAGTTGGTGTTCTTTCTCAGCTTGAAGTTGGTTTTTATACTAACTCATGTGGTTTA
GCTGAGTTCATTGTGAAAGACGAGGTTAGGGCTGCTTTCGCTAAGGATAAAGGAGTCGCTGCTGGTCTTGTAAGAATGCACTTTCACGATTGCTTTGTTAGG
GGGTGTGACGCTTCTGTT
CTTATTGACTCCACACCCTCAAACACAGCAGAGAAAGACTCGGCAGTCAATAACCCAAGCCTGAGGGGATTTGAAGTCATTGACAAAGCAAAGTCTAGACTAGAAGCTCTTTGTGAAGGA
ATTGTTTCCTGTGCTGATGTACTCGCATTTGCAGCAAGAGATAGCGTTGAGTTA
ACTGGAGGGCTTGGCTATGATGTTCCTGCAGGAAGAAGAGATGGCAAAATTTCATTAGCCTCAGAA
ACTTTAACAAACTTACCTGGTCCAACATTCAATGTCAACCAGCTTACTCAATCATTTGCAGACAAGGGTTTGTCGCAAGATGAAATGGTTACACTTTCTG
GAGCACACACCATAGGTCGT
TCCCACTGCACTTCCTTCAGTAACAGATTATACAAATTCAATGGAACAAATAGCCAGGATCCAAGCTTAGATGGAACGTATGCAGCCAGGTTGAAGCAGCAGTGCCCACAAGGGAACACT
GATCCTAGCTTGGTGGTGCCAATGGACCCTTCTAGTCCAAGCACAACAGACGTAGGTTATTACATAGATGTCCAAGCAAACCGAGGGTTGTTCACTTCAGACCAGACTCTCATGACAAAC
CCAGCAACAGCAAACCAAGTGAATCTAAATGCAAGAAATGTCAATCTTTGGAGAAGTAAATTTGCTACAGCCATGGTGAAGATGGGTCAAATTGATGTTTTGACAGGTGCAGATTCTGGA
GAGATTCGAACAAACTGTAGGGTCGTCAACACC

Retrieve as FASTA