Entry information : MePrx122 ( cassava4.1_030603m)
Entry ID 9080
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-28 (Achraf Jemmat)
Peroxidase information: MePrx122 ( cassava4.1_030603m)
Name (synonym) MePrx122 ( cassava4.1_030603m)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx122
start..stop
S start..stop
RcPrx10 517 0 1..343 1..327
MePrx106 498 2e-179 1..343 1..328
PtPrx28 485 4e-174 1..343 1..327
PtPrx29 484 5e-174 1..343 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3208..3477 270 N° 2 2712..2900 189 N° 3 2454..2619 166 N° 4 1898..2301 404
complement(join(1898..2301,2454..2619,2712..2900,3208..3477))


exon

Literature and cross-references MePrx122 ( cassava4.1_030603m)
DNA ref. Phytozome 12:   scaffold05968 (3477..1898)
Protein sequence: MePrx122 ( cassava4.1_030603m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (317)
PWM (Da):   %s   36630.86 (33648.1)  
PI (pH):   %s   7.72 (7.72) Peptide Signal:   %s   cut: 27 range:27-343
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIQKLLPLQFFQLVLFLLLLDLANSQVLQVGVQVGLGITTSQGLQLGFYGQTCPNAEKTIHDMVQQFIDKDPTLAAPLLRMHFHDCFVRGCDGSVLLNSTNTNQAEKDAVPNQTLRGFNVIDTIKSAIEKDCPGVVSCADILALVARDSVAMVGGPSWVVRTGRKDGRISSASEASAQLPSPFASINQLKQNFAAKGLSVKDLVVLSGGHTIGIGHCFVIANRLYNFSGRGDTDPSLDPAYAAQLKTKCKPGDTTTVVDMDPGSPKLFDDDYYTVVARRRGLFQSDAALLNDIQTRAYVTLQAATNGVTFARDFGASMVKLGNVGVLTGSQGEIRKQCALV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTCAAAAGCTTCTTCCACTTCAGTTTTTTCAACTGGTTCTCTTCCTCCTGCTCCTAGACCTAGCTAATTCCCAAGTATTACAAGTTGGTGTACAGGTTGGCTTGGGCATAACT
ACTTCTCAAGGGTTACAACTCGGATTCTATGGCCAGACATGTCCGAATGCAGAGAAAACTATCCATGATATGGTTCAACAATTCATTGACAAGGATCCGACACTTGCTGCTCCTTTACTA
AGAATGCATTTTCATGACTGTTTTGTTAGG
GTAAGTTCTATGTTATCATTATTTCGGTAGAGTTAACAAAATTCAGTTTATTATTAAAACATGAAAGTTTTAAGGTTAAAGTTGAAAATT
TACCCTTGAACTATACAATCATGATTAAATATACTAAATTTTTTAACTTTCGATAGCGATGTCTATTCTATTTGATCTATTTGGTCTTTTAATAATATTTAGTAGAAAATTTGATAAAAA
ATGAAATTTGGTAGCCTGTTCGGTTGCAAATTTGACTTTTTTGCCGAAGTTTTACTGATATGTTCTCCACCCATATATAATTGCATGCATGTGACAGGGATGTGATGGTTCTGTGCTACT
GAATTCTACAAACACTAATCAAGCTGAGAAAGATGCAGTCCCAAACCAAACCTTACGAGGTTTCAATGTTATTGATACTATAAAATCTGCAATAGAAAAGGATTGTCCTGGTGTTGTTTC
TTGTGCTGATATTTTGGCTTTGGTAGCTCGAGATTCAGTTGCTATG
GTATTATCTCCTTCCGCAAAATTCATCAAATGCTTAATTATATCCATGCATATATGTCTAATGATAAGATCGAT
TAATCATTTTGTATTCAGGTTGGCGGACCATCTTGGGTTGTTCGCACGGGACGTAAAGATGGAAGAATCTCTAGTGCTTCAGAGGCTTCAGCACAGTTACCATCTCCTTTCGCCAGTATA
AATCAACTGAAGCAAAACTTTGCTGCAAAGGGTTTAAGTGTAAAGGATCTAGTGGTTCTATCAG
GTTAGATAGCTAACAACTTAACAGTAAAAAAAATTGCTTGTCTTGTTAGAGATCCG
AGGAGCCTGTAAAACTCCTGGAAAGAAAGTAAAAATTTACGGGACTTTATAAAAGACAAAGAAAAGATTATAACTCCAAGTCCTTGTTGTTTGCAGGAGGACACACCATTGGAATTGGCC
ATTGCTTTGTAATCGCAAATCGTTTGTACAATTTCAGTGGGAGAGGCGACACAGACCCATCATTGGACCCAGCATATGCAGCCCAATTGAAGACGAAATGTAAGCCTGGAGACACCACCA
CAGTCGTAGATATGGACCCTGGAAGCCCCAAATTATTCGATGACGATTACTACACAGTTGTTGCTAGAAGGAGAGGGCTCTTCCAATCTGATGCAGCTCTTCTCAACGATATCCAAACAA
GAGCTTATGTCACATTGCAAGCTGCAACCAATGGAGTCACTTTCGCTCGAGATTTTGGTGCGTCAATGGTGAAACTAGGCAACGTTGGAGTCCTCACTGGCAGCCAAGGTGAAATCAGGA
AACAGTGTGCCCTAGTAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTATTCAAAAGCTTCTTCCACTTCAGTTTTTTCAACTGGTTCTCTTCCTCCTGCTCCTAGACCTAGCTAATTCCCAAGTATTACAAGTTGGTGTACAGGTTGGCTTGGGCATAACT
ACTTCTCAAGGGTTACAACTCGGATTCTATGGCCAGACATGTCCGAATGCAGAGAAAACTATCCATGATATGGTTCAACAATTCATTGACAAGGATCCGACACTTGCTGCTCCTTTACTA
AGAATGCATTTTCATGACTGTTTTGTTAGG
GGATGTGATGGTTCTGTGCTACTGAATTCTACAAACACTAATCAAGCTGAGAAAGATGCAGTCCCAAACCAAACCTTACGAGGTTTCAAT
GTTATTGATACTATAAAATCTGCAATAGAAAAGGATTGTCCTGGTGTTGTTTCTTGTGCTGATATTTTGGCTTTGGTAGCTCGAGATTCAGTTGCTATG
GTTGGCGGACCATCTTGGGTT
GTTCGCACGGGACGTAAAGATGGAAGAATCTCTAGTGCTTCAGAGGCTTCAGCACAGTTACCATCTCCTTTCGCCAGTATAAATCAACTGAAGCAAAACTTTGCTGCAAAGGGTTTAAGT
GTAAAGGATCTAGTGGTTCTATCAG
GAGGACACACCATTGGAATTGGCCATTGCTTTGTAATCGCAAATCGTTTGTACAATTTCAGTGGGAGAGGCGACACAGACCCATCATTGGACCCA
GCATATGCAGCCCAATTGAAGACGAAATGTAAGCCTGGAGACACCACCACAGTCGTAGATATGGACCCTGGAAGCCCCAAATTATTCGATGACGATTACTACACAGTTGTTGCTAGAAGG
AGAGGGCTCTTCCAATCTGATGCAGCTCTTCTCAACGATATCCAAACAAGAGCTTATGTCACATTGCAAGCTGCAACCAATGGAGTCACTTTCGCTCGAGATTTTGGTGCGTCAATGGTG
AAACTAGGCAACGTTGGAGTCCTCACTGGCAGCCAAGGTGAAATCAGGAAACAGTGTGCCCTAGTAAAT

Retrieve as FASTA