Entry information : MePrx123 ( cassava4.1_030936m)
Entry ID 9081
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-16 (Christophe Dunand)
Peroxidase information: MePrx123 ( cassava4.1_030936m)
Name (synonym) MePrx123 ( cassava4.1_030936m)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx123
start..stop
S start..stop
MePrx35 524 0 1..316 1..316
LcPrx01 483 6e-174 6..316 7..317
CppPrx06 482 1e-173 6..316 8..317
CclPrx48 482 1e-173 6..316 10..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 126535..126741 207 N° 2 126812..127003 192 N° 3 127094..127259 166 N° 4 127348..127730 383
join(126535..126741,126812..127003,127094..127259,127348..127730)


exon

Literature and cross-references MePrx123 ( cassava4.1_030936m)
DNA ref. Phytozome 12:   scaffold10689 (126535..127730)
Protein sequence: MePrx123 ( cassava4.1_030936m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   34135.61 (31864.5)  
PI (pH):   %s   9.93 (10.07) Peptide Signal:   %s   cut: 23 range:23-316
Sequence 357
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFQNFLLLSLVAACTSAVAYGNLSVNYYSSTCPKALSIIHAGVAAAIKKEPRMGASLLRLHFHDCFVNGCDGSILLDDNATFIGEKTAVVNNNSIRGFSVIDHIKAKVEKACPGVVSCADIVALAARDSVVYFGGPSWKVRLGRRDSLTASRALANSSIPPATFNLSALITSFSAQGLSLRNLVALSGSHTIGLARCATFRGHIYNDSNIDPSFAKSLRRICPRSGRDNVLAPLDRHTPACFDNLYYKHLLQGKGLLHSDQELFNGSSADFLVRRYASNPHDFFKDFAKAMVKMSNIKPLTGKQGEVRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTTCAGAACTTTCTGTTGCTTTCTTTGGTTGCTGCATGTACATCTGCCGTGGCATATGGCAACCTATCTGTGAATTATTACTCGTCTACGTGCCCAAAAGCTTTATCTATCATTC
ATGCAGGAGTAGCAGCAGCAATAAAAAAGGAACCTCGCATGGGGGCATCATTGCTCAGATTGCATTTTCATGACTGCTTTGTTAAT
GTAAGCATGTTTCTGCTTTTTACGTACTCAGCTT
TATGTGATCATAGTACTTATGTCGTAATCATTACAGGGCTGCGACGGATCGATCCTGTTAGATGATAATGCCACCTTCATAGGAGAGAAAACTGCTGTTGTTAACAATAACTCCATCAGA
GGATTCAGTGTCATTGATCACATCAAAGCTAAGGTAGAAAAAGCTTGTCCTGGTGTTGTGTCTTGCGCTGATATCGTCGCCCTGGCGGCTCGAGACTCGGTTGTTTAT
GTGAGTTGCATA
TGTTACGGTAGGAGATTTACCTTCTCAGAGTACATAACCAAAATGGGTGGATGTGTTTTTTTTTTTTGGCCTGTGCAGTTTGGGGGTCCTTCTTGGAAGGTTAGGTTGGGAAGAAGAGAT
TCTCTCACAGCAAGCAGGGCACTTGCAAATAGTTCTATACCTCCAGCTACTTTTAATCTAAGTGCCCTCATAACAAGCTTCTCTGCACAGGGGCTCTCTTTAAGGAACTTGGTGGCTCTT
TCAG
GTTAAGTCCTGGTTAGCCTTTCATGATTCTTTTCAACAAGCTTATTTAAAAATATGCATCCTGAAATTTCAACTTACCTGGATGGCAGGTTCCCACACCATAGGCCTGGCCAGATG
CGCAACCTTTCGAGGGCATATCTACAATGATTCGAATATTGATCCCTCCTTTGCCAAGTCATTGCGGCGGATTTGCCCAAGAAGTGGGAGAGACAATGTTCTTGCACCCCTTGATCGGCA
TACTCCAGCTTGTTTTGATAATCTGTACTACAAGCACCTGTTGCAAGGGAAGGGTCTTCTTCATTCAGATCAAGAACTCTTCAATGGCAGTTCTGCAGATTTCCTTGTTAGAAGATATGC
AAGTAATCCTCATGATTTTTTCAAAGACTTTGCTAAAGCTATGGTTAAGATGAGCAACATTAAGCCCCTCACAGGAAAACAGGGTGAAGTAAGAAAAAATTGCAGAAAAGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTTCAGAACTTTCTGTTGCTTTCTTTGGTTGCTGCATGTACATCTGCCGTGGCATATGGCAACCTATCTGTGAATTATTACTCGTCTACGTGCCCAAAAGCTTTATCTATCATTC
ATGCAGGAGTAGCAGCAGCAATAAAAAAGGAACCTCGCATGGGGGCATCATTGCTCAGATTGCATTTTCATGACTGCTTTGTTAAT
GGCTGCGACGGATCGATCCTGTTAGATGATAATG
CCACCTTCATAGGAGAGAAAACTGCTGTTGTTAACAATAACTCCATCAGAGGATTCAGTGTCATTGATCACATCAAAGCTAAGGTAGAAAAAGCTTGTCCTGGTGTTGTGTCTTGCGCTG
ATATCGTCGCCCTGGCGGCTCGAGACTCGGTTGTTTAT
TTTGGGGGTCCTTCTTGGAAGGTTAGGTTGGGAAGAAGAGATTCTCTCACAGCAAGCAGGGCACTTGCAAATAGTTCTATAC
CTCCAGCTACTTTTAATCTAAGTGCCCTCATAACAAGCTTCTCTGCACAGGGGCTCTCTTTAAGGAACTTGGTGGCTCTTTCAG
GTTCCCACACCATAGGCCTGGCCAGATGCGCAACCT
TTCGAGGGCATATCTACAATGATTCGAATATTGATCCCTCCTTTGCCAAGTCATTGCGGCGGATTTGCCCAAGAAGTGGGAGAGACAATGTTCTTGCACCCCTTGATCGGCATACTCCAG
CTTGTTTTGATAATCTGTACTACAAGCACCTGTTGCAAGGGAAGGGTCTTCTTCATTCAGATCAAGAACTCTTCAATGGCAGTTCTGCAGATTTCCTTGTTAGAAGATATGCAAGTAATC
CTCATGATTTTTTCAAAGACTTTGCTAAAGCTATGGTTAAGATGAGCAACATTAAGCCCCTCACAGGAAAACAGGGTGAAGTAAGAAAAAATTGCAGAAAAGTTAAT

Retrieve as FASTA