Entry information : MePrx125 (cassava4.1_031254m)
Entry ID 9083
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2015-11-25 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-26 (Achraf Jemmat)
Peroxidase information: MePrx125 (cassava4.1_031254m)
Name (synonym) MePrx125 (cassava4.1_031254m)
Class Class III peroxidase    [Orthogroup: Prx189]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx125
start..stop
S start..stop
MePrx137 535 0 29..350 30..351
MePrx100 513 0 1..351 1..351
MePrx13 512 0 1..353 1..352
MePrx87 420 7e-148 36..349 33..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 869906..870160 255 N° 2 870272..870454 183 N° 3 870538..871161 624  
join(869906..870160,870272..870454,870538..871161)


exon

Literature and cross-references MePrx125 (cassava4.1_031254m)
DNA ref. Phytozome 12:   scaffold06814 (869906..871158)
Protein sequence: MePrx125 (cassava4.1_031254m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (326)
PWM (Da):   %s   39189.88 (36400.4)  
PI (pH):   %s   6.66 (6.05) Peptide Signal:   %s   cut: 28 range:28-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATAKSLRSPLFIPFLLLASCLSSANGEKFKANVTIANGLAYGFYRYTCPQVEFIVRKYLMQVYRRDVGQAAGILRLHSHDCFVQGCDGSVLLDRSPERTELPNLSLRPQSFEIIETLRQIVHSQCGRVVSCSDLLTLAARDAVFFTGGLDYAVPLGRRDGVTFPRINQTFEDLVAPTAKTTEILTKFARKDLNLVDTVALSGAHSIGIAHCITFEERLFPDRDPTMEVSLFNSLRQVCPAPGATAPVWLDFRSPNRFDNLYYIDLMNRQGIFTSDQDLFEDPRTRPTVISFAANQRLFFRNFAIAMTKMGIVDVLTDGQGEIRGRCSMRNSDVNDLESVVEQDLGPSSSASI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTGCTAAATCTCTCAGATCTCCCCTTTTCATCCCTTTTCTTTTGCTGGCCTCGTGCCTTAGCAGTGCTAATGGTGAAAAATTCAAAGCTAATGTTACAATAGCTAATGGTCTG
GCGTATGGATTCTACAGATACACATGTCCTCAGGTTGAATTTATTGTCAGAAAGTATCTGATGCAAGTTTACAGGAGGGACGTCGGCCAAGCAGCTGGAATTCTTCGTCTCCACTCCCAT
GACTGCTTTGTTCAG
GTCACTATCTCTCTTAATTCTCAGCCATCTCCAGCTTTCTGAAATGGGCTTATAATATTTATTTTATTGTTAAATTTTGATGTGCATGCATGGCTAAATCAAATC
AAACAGGGATGCGATGGATCGGTGTTGCTGGATAGATCACCCGAGAGGACGGAACTTCCCAACTTGAGCTTGAGACCACAGTCGTTTGAGATCATAGAAACTCTTCGCCAAATTGTACAC
TCGCAGTGTGGCCGTGTCGTCTCTTGTTCTGATCTTCTCACACTTGCCGCTCGTGACGCCGTCTTCTTT
GTAACTCACTACTACTTTCTTTCATTGCAAGCATGGTGGTTTGTTAGATTC
TAATTATTATTATATTATTGTTATTATTACAGACAGGTGGGCTTGACTATGCAGTCCCTTTAGGAAGGCGAGATGGGGTAACATTCCCAAGAATAAACCAAACATTTGAAGACCTGGTGG
CTCCAACTGCTAAAACAACTGAAATTCTAACAAAGTTTGCTCGAAAAGACTTAAATTTAGTCGACACTGTAGCCCTGTCCGGAGCTCACAGCATTGGCATCGCCCATTGCATCACTTTTG
AGGAACGTCTGTTTCCTGATAGAGATCCGACAATGGAAGTTTCTCTCTTCAACAGTCTTAGGCAAGTTTGTCCTGCACCAGGCGCCACAGCTCCAGTCTGGTTGGATTTTCGATCCCCTA
ACAGATTCGACAACTTGTACTACATTGATCTCATGAACCGCCAGGGCATATTTACCTCGGACCAAGATTTGTTTGAAGATCCTAGGACGAGGCCAACTGTTATTAGTTTTGCTGCTAACC
AACGTTTGTTCTTCAGGAACTTCGCCATTGCCATGACCAAAATGGGGATTGTGGATGTGTTGACAGATGGACAAGGGGAAATTCGTGGCAGATGCAGCATGAGGAATTCTGATGTTAACG
ATTTGGAGTCTGTAGTGGAACAGGATCTGGGTCCATCATCCTCTGCTTCCATTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTGCTAAATCTCTCAGATCTCCCCTTTTCATCCCTTTTCTTTTGCTGGCCTCGTGCCTTAGCAGTGCTAATGGTGAAAAATTCAAAGCTAATGTTACAATAGCTAATGGTCTG
GCGTATGGATTCTACAGATACACATGTCCTCAGGTTGAATTTATTGTCAGAAAGTATCTGATGCAAGTTTACAGGAGGGACGTCGGCCAAGCAGCTGGAATTCTTCGTCTCCACTCCCAT
GACTGCTTTGTTCAG
GGATGCGATGGATCGGTGTTGCTGGATAGATCACCCGAGAGGACGGAACTTCCCAACTTGAGCTTGAGACCACAGTCGTTTGAGATCATAGAAACTCTTCGCCAA
ATTGTACACTCGCAGTGTGGCCGTGTCGTCTCTTGTTCTGATCTTCTCACACTTGCCGCTCGTGACGCCGTCTTCTTT
ACAGGTGGGCTTGACTATGCAGTCCCTTTAGGAAGGCGAGAT
GGGGTAACATTCCCAAGAATAAACCAAACATTTGAAGACCTGGTGGCTCCAACTGCTAAAACAACTGAAATTCTAACAAAGTTTGCTCGAAAAGACTTAAATTTAGTCGACACTGTAGCC
CTGTCCGGAGCTCACAGCATTGGCATCGCCCATTGCATCACTTTTGAGGAACGTCTGTTTCCTGATAGAGATCCGACAATGGAAGTTTCTCTCTTCAACAGTCTTAGGCAAGTTTGTCCT
GCACCAGGCGCCACAGCTCCAGTCTGGTTGGATTTTCGATCCCCTAACAGATTCGACAACTTGTACTACATTGATCTCATGAACCGCCAGGGCATATTTACCTCGGACCAAGATTTGTTT
GAAGATCCTAGGACGAGGCCAACTGTTATTAGTTTTGCTGCTAACCAACGTTTGTTCTTCAGGAACTTCGCCATTGCCATGACCAAAATGGGGATTGTGGATGTGTTGACAGATGGACAA
GGGGAAATTCGTGGCAGATGCAGCATGAGGAATTCTGATGTTAACGATTTGGAGTCTGTAGTGGAACAGGATCTGGGTCCATCATCCTCTGCTTCCATTTAA

Retrieve as FASTA