Entry information : MePrx13 (cassava4.1_010776m)
Entry ID 9087
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-25 (Christophe Dunand)
Peroxidase information: MePrx13 (cassava4.1_010776m)
Name (synonym) MePrx13 (cassava4.1_010776m)
Class Class III peroxidase    [Orthogroup: Prx189]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx13
start..stop
S start..stop
MePrx100 578 0 1..352 1..352
MePrx125 536 0 1..352 1..353
MePrx137 477 2e-170 1..350 1..351
MePrx09 392 9e-137 4..352 2..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 850378..850632 255 N° 2 850725..850907 183 N° 3 850992..851609 618  
join(850378..850632,850725..850907,850992..851609)


exon

Literature and cross-references MePrx13 (cassava4.1_010776m)
DNA ref. Phytozome 12:   scaffold06814 (850378..851609)
Protein sequence: MePrx13 (cassava4.1_010776m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352
PWM (Da):   %s   39256.58  
PI (pH):   %s   7.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKAKSFTLLPFISFLLLASCLSSSSGEQFKANVTIANGLAYGYYNYICPQVEGLVRNYLMQVYRSDAGQAAAILRLQSHDCFVQGCDGSVLLDRSPERSEIPNKDFKQQTFQIIENLRQIVHYYCGRVVSCSDLLTLAARDAVFFTGGPDFSVPLGRRDGVTFPRPGQTSEDLIAPTAKTTDILARFARKGLNFVDAVALSGAHTIGIAHCSSFRGRLFPNRDPTMEFSFYDRLSRYCASPAIDPLVWLDFRSPFRFDNLYFVDLMNRQGLFTSDQDLFEDPRTRGTVINFAYNQQQFFVNFAAAMIRMGIVGVLTDGQGEIRARCNMRNSDFYNLESVLEKDNISSSAAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAAGCTAAATCTTTCACTCTTCTCCCTTTCATTTCTTTTCTCCTGCTGGCTTCTTGCCTTAGTAGTTCTAGTGGGGAACAATTCAAAGCTAATGTTACTATAGCTAATGGTCTG
GCGTATGGATATTACAATTACATATGTCCTCAGGTTGAAGGTCTTGTAAGAAATTATCTGATGCAAGTCTACAGAAGTGACGCAGGTCAAGCAGCTGCAATACTTCGTCTCCAATCCCAT
GACTGCTTTGTTCAG
GTCATTCTCTGTGATCTCTAGCTTTTTGAAATGGGATGTAAGCTTATGTTTATTGTATTGTTGAATCTGGATGTGCATGAAAAATTAAACAGGGATGCGATGGAT
CGGTATTGCTTGATAGATCACCCGAGAGGAGTGAGATTCCCAACAAGGACTTCAAACAACAGACATTTCAGATCATTGAAAATCTCCGCCAAATTGTCCACTATTATTGCGGCCGTGTCG
TCTCTTGTTCTGATCTTCTCACACTCGCTGCTCGTGATGCCGTCTTCTTT
GTAAGTTGGAACTCACTACTCTTAGTGCGGGTGTGTCGTCTCTTTTATTAAAAATTTTAATGATTACTGT
TGTCATTATTACAGACAGGTGGCCCTGACTTTTCAGTCCCTTTAGGGAGGCGAGATGGGGTAACATTCCCCAGACCAGGACAAACAAGTGAAGACCTGATAGCTCCTACTGCTAAAACAA
CTGACATACTAGCGAGGTTTGCTCGAAAAGGCTTGAATTTTGTCGACGCTGTAGCCCTCTCAGGTGCCCACACTATTGGCATCGCCCATTGCAGCTCTTTCCGAGGACGTCTGTTTCCTA
ATAGAGATCCCACCATGGAATTTTCCTTCTACGACAGACTTAGCCGTTACTGTGCTTCTCCAGCCATCGACCCTCTAGTTTGGTTGGATTTTCGATCCCCTTTCAGATTCGACAACCTGT
ACTTCGTTGATCTTATGAACCGACAGGGTTTGTTTACTTCAGACCAAGATTTGTTCGAAGATCCAAGGACTAGGGGAACTGTTATTAATTTTGCTTATAACCAACAGCAGTTTTTCGTGA
ACTTCGCAGCTGCCATGATCAGAATGGGGATTGTGGGAGTGTTGACAGATGGACAAGGGGAAATTCGTGCGAGGTGTAACATGAGGAATTCTGATTTCTATAATTTGGAGTCTGTATTGG
AAAAAGATAACATTTCATCCTCTGCAGCTATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAAGCTAAATCTTTCACTCTTCTCCCTTTCATTTCTTTTCTCCTGCTGGCTTCTTGCCTTAGTAGTTCTAGTGGGGAACAATTCAAAGCTAATGTTACTATAGCTAATGGTCTG
GCGTATGGATATTACAATTACATATGTCCTCAGGTTGAAGGTCTTGTAAGAAATTATCTGATGCAAGTCTACAGAAGTGACGCAGGTCAAGCAGCTGCAATACTTCGTCTCCAATCCCAT
GACTGCTTTGTTCAG
GGATGCGATGGATCGGTATTGCTTGATAGATCACCCGAGAGGAGTGAGATTCCCAACAAGGACTTCAAACAACAGACATTTCAGATCATTGAAAATCTCCGCCAA
ATTGTCCACTATTATTGCGGCCGTGTCGTCTCTTGTTCTGATCTTCTCACACTCGCTGCTCGTGATGCCGTCTTCTTT
ACAGGTGGCCCTGACTTTTCAGTCCCTTTAGGGAGGCGAGAT
GGGGTAACATTCCCCAGACCAGGACAAACAAGTGAAGACCTGATAGCTCCTACTGCTAAAACAACTGACATACTAGCGAGGTTTGCTCGAAAAGGCTTGAATTTTGTCGACGCTGTAGCC
CTCTCAGGTGCCCACACTATTGGCATCGCCCATTGCAGCTCTTTCCGAGGACGTCTGTTTCCTAATAGAGATCCCACCATGGAATTTTCCTTCTACGACAGACTTAGCCGTTACTGTGCT
TCTCCAGCCATCGACCCTCTAGTTTGGTTGGATTTTCGATCCCCTTTCAGATTCGACAACCTGTACTTCGTTGATCTTATGAACCGACAGGGTTTGTTTACTTCAGACCAAGATTTGTTC
GAAGATCCAAGGACTAGGGGAACTGTTATTAATTTTGCTTATAACCAACAGCAGTTTTTCGTGAACTTCGCAGCTGCCATGATCAGAATGGGGATTGTGGGAGTGTTGACAGATGGACAA
GGGGAAATTCGTGCGAGGTGTAACATGAGGAATTCTGATTTCTATAATTTGGAGTCTGTATTGGAAAAAGATAACATTTCATCCTCTGCAGCTATT

Retrieve as FASTA