Entry information : MePrx132 (cassava4.1_031903m)
Entry ID 9089
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang LI)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx132 (cassava4.1_031903m)
Name (synonym) MePrx132 (cassava4.1_031903m)
Class Class III peroxidase     [Orthogroup: Prx030]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx132
start..stop
S start..stop
MePrx06 246 2e-83 1..140 1..140
PbPrx06 213 1e-72 15..140 17..142
PtPrx08 214 1e-70 24..140 25..141
PtrePrx03 207 5e-68 24..140 24..140
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7058..7139 82 N° 2 6744..6892 149 N° 3 6467..6655 189  
complement(join(6467..6655,6744..6892,7058..7139))


exon

Literature and cross-references MePrx132 (cassava4.1_031903m)
DNA ref. Phytozome 12:   scaffold08959 (7139..6467)
Protein sequence: MePrx132 (cassava4.1_031903m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   140 (112)
PWM (Da):   %s   15442.85 (12287.1) Transmb domain:   %s   i9-28o
PI (pH):   %s   7.34 (6.49) Peptide Signal:   %s   cut: 29 range:29-140
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTNSTQRGTSTLLLFILLPLLLQFYHGRSELQLNYYAQSCPRAEDIIKEQVTNLYKKHGNTAVSWVRNLFHDCGVSCDASLLLESANGIESEKASQRNFGMRNLKYVNTIKDAVEAECPLTVSCADIVALSARDGIVM

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing due to NNNN in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACCAACTCTACCCAACGTGGCACTTCAACCCTCCTCCTATTTATCTTATTGCCGTTGCTCTTGCAATTTTATCATGGTAATGTTCATAATATATACTTCTACAAGAAATTCTAG
CTTCATTAGCACATTATTTAATTGTTACTTCTTGTTAAAATGAATTCTTAATTATGACGATGTACATGTACCGGTGTGCTGAATAATATTTCATTATTGTGTAATATACGGTGACTGTTG
AGCTCAGGTAGAAGTGAACTCCAACTAAACTACTATGCACAAAGTTGCCCAAGAGCTGAAGACATCATCAAAGAGCAAGTCACTAATCTATACAAGAAACATGGAAATACAGCAGTTTCC
TGGGTTAGGAATCTCTTCCATGATTGTGGGGTGAAG
GTATTATATTATTTTGGTTAATTAATCAATTGTTAATTACGTTTCATAGTTGGTTCATTAATTGTCTATATGGGCATAAATGAT
TCAGTCGTGTGATGCATCGCTGTTGTTGGAGTCGGCAAACGGAATTGAATCGGAGAAAGCATCACAGAGGAACTTTGGAATGAGAAATTTGAAGTATGTGAACACAATCAAAGATGCAGT
TGAAGCTGAATGCCCTTTGACCGTCTCTTGTGCTGATATTGTTGCTCTTTCTGCAAGAGATGGTATTGTCATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCACCAACTCTACCCAACGTGGCACTTCAACCCTCCTCCTATTTATCTTATTGCCGTTGCTCTTGCAATTTTATCATGGTAGAAGTGAACTCCAACTAAACTACTATGCACAAAGT
TGCCCAAGAGCTGAAGACATCATCAAAGAGCAAGTCACTAATCTATACAAGAAACATGGAAATACAGCAGTTTCCTGGGTTAGGAATCTCTTCCATGATTGTGGGGTGAAG
TCGTGTGAT
GCATCGCTGTTGTTGGAGTCGGCAAACGGAATTGAATCGGAGAAAGCATCACAGAGGAACTTTGGAATGAGAAATTTGAAGTATGTGAACACAATCAAAGATGCAGTTGAAGCTGAATGC
CCTTTGACCGTCTCTTGTGCTGATATTGTTGCTCTTTCTGCAAGAGATGGTATTGTCATG

Retrieve as FASTA