Entry information : MePrx135 ( cassava4.1_032435m)
Entry ID 9092
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-01-28 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-28 (Achraf Jemmat)
Peroxidase information: MePrx135 ( cassava4.1_032435m)
Name (synonym) MePrx135 ( cassava4.1_032435m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx135
start..stop
S start..stop
GrPrx41 505 0 11..329 14..333
GhPrx41 495 2.13e-178 11..329 14..332
PtPrx97 482 1.57e-173 19..328 2..309
PpePrx79 482 4.19e-173 12..328 15..332
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9092' 'join(524451..524666,524756..524938,525081..525241,525317..525743)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 524451..524666 214 N° 2 524756..524938 181 N° 3 525081..525241 159 N° 4 525317..525743 425
join(524451..524666,524756..524938,525081..525241,525317..525743)


exon

Literature and cross-references MePrx135 ( cassava4.1_032435m)
DNA ref. Phytozome 12:   scaffold03542 (524451..525740)
Protein sequence: MePrx135 ( cassava4.1_032435m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (303)
PWM (Da):   %s   35112.63 (32239.1)  
PI (pH):   %s   7.26 (6.12) Peptide Signal:   %s   cut: 26 range:26-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRSTSYQCLSVFVTVLTLCVAVRTQLTADFYSKTCPTLPQIVRRVVLNAIKTEMRMAASLLRLHFHDCFVNGCDGSVLLDGTDVEKFSAANLNSARGFEVVDAIKSAVESQCSGVVSCA
DILALAARDSTLLSGGPSWKVLLGRRDGTVSSKAQANISLPSPFDNLDAIIAKYAAVGLNITDVVSLSGGHTIGLAKCATFSNRLFNFSGTGAPDNTLESSMLSDLQNLCPINGDGNKTT
VFDRDSADLFDNHYFKNLVNNRGLLGSDQVLFSSSLADSTTKSIVESYSSNNKLFFDDFANSMIKMGNISPLTGSSGEIRKNCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGTCAACCAGCTATCAATGTCTCTCTGTGTTTGTGACTGTTTTGACGTTATGTGTTGCTGTGAGAACTCAACTCACTGCTGATTTCTATTCCAAAACTTGTCCTACACTTCCT
CAAATCGTCCGAAGAGTGGTTCTAAATGCTATCAAGACCGAAATGCGAATGGCTGCCTCTCTACTCCGCCTTCATTTTCATGATTGCTTTGTTAAT
ATGTAAGTGGTGTCTTTTATTTTC
TAAACTAGGCTTTGTTGGAATTATATCAGAAACATTAATTTGCTTAATTAAAAAATTTTGATAACAGGGTTGTGATGGGTCAGTTTTGCTGGATGGAACTGACGTTGAGAAGTTCTCGGC
AGCTAATTTAAACTCAGCAAGAGGATTTGAAGTTGTGGACGCTATAAAATCTGCCGTGGAAAGTCAGTGTAGTGGAGTTGTATCTTGTGCTGACATACTTGCCTTAGCTGCCCGAGATTC
TACTCTCTTG
TGGTTAGTTCGACCTTGTCCATCTAAAATTCTTAGACACTTAATTTATCATGAAACTATACAGAATTTTTTAAAAAAAAATTTGATTAATTAATACTGTGATTTTTTTTT
ATATATATATATAACTTATATTAATGGCTCTTAGAGTGGAGGGCCATCATGGAAAGTTCTCCTTGGAAGAAGAGATGGAACGGTGTCTAGCAAAGCACAGGCAAATATTTCATTGCCTTC
TCCGTTTGACAACCTAGACGCAATCATTGCCAAATATGCTGCTGTAGGCCTCAACATCACCGATGTTGTGTCCTT
TTATCAGGTAATCCTCACAAAGATTTGGACTAATTTGTAAAATTA
CTTAGTGCGCTCAATAATGGTTATTTTTCAAGTGCAGGTGGTCACACAATTGGACTAGCAAAATGTGCCACCTTCAGCAATAGATTGTTCAACTTCTCAGGAACTGGAGCTCCTGACAAT
ACATTGGAATCGAGTATGTTGTCTGATCTGCAAAACCTATGTCCGATAAACGGAGACGGAAACAAGACCACGGTTTTTGATCGGGACTCTGCCGATCTATTTGACAACCATTATTTCAAG
AATTTGGTAAACAATAGGGGGCTGCTTGGTTCAGACCAAGTTCTGTTTTCAAGCAGTTTGGCTGATTCGACAACCAAAAGTATTGTTGAAAGCTACAGCAGTAACAACAAGCTTTTCTTT
GATGATTTTGCAAATTCGATGATAAAAATGGGGAATATAAGTCCACTCACAGGGTCTAGTGGAGAGATCAGGAAGAATTGCAGAGTTGTTAATTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAGGTCAACCAGCTATCAATGTCTCTCTGTGTTTGTGACTGTTTTGACGTTATGTGTTGCTGTGAGAACTCAACTCACTGCTGATTTCTATTCCAAAACTTGTCCTACACTTCCT
CAAATCGTCCGAAGAGTGGTTCTAAATGCTATCAAGACCGAAATGCGAATGGCTGCCTCTCTACTCCGCCTTCATTTTCATGATTGCTTTGTTAAT
GGTTGTGATGGGTCAGTTTTGCTG
GATGGAACTGACGTTGAGAAGTTCTCGGCAGCTAATTTAAACTCAGCAAGAGGATTTGAAGTTGTGGACGCTATAAAATCTGCCGTGGAAAGTCAGTGTAGTGGAGTTGTATCTTGTGCT
GACATACTTGCCTTAGCTGCCCGAGATTCTACTCTCTTG
AGTGGAGGGCCATCATGGAAAGTTCTCCTTGGAAGAAGAGATGGAACGGTGTCTAGCAAAGCACAGGCAAATATTTCATTG
CCTTCTCCGTTTGACAACCTAGACGCAATCATTGCCAAATATGCTGCTGTAGGCCTCAACATCACCGATGTTGTGTCCTT
TGCAGGTGGTCACACAATTGGACTAGCAAAATGTGCCACC
TTCAGCAATAGATTGTTCAACTTCTCAGGAACTGGAGCTCCTGACAATACATTGGAATCGAGTATGTTGTCTGATCTGCAAAACCTATGTCCGATAAACGGAGACGGAAACAAGACCACG
GTTTTTGATCGGGACTCTGCCGATCTATTTGACAACCATTATTTCAAGAATTTGGTAAACAATAGGGGGCTGCTTGGTTCAGACCAAGTTCTGTTTTCAAGCAGTTTGGCTGATTCGACA
ACCAAAAGTATTGTTGAAAGCTACAGCAGTAACAACAAGCTTTTCTTTGATGATTTTGCAAATTCGATGATAAAAATGGGGAATATAAGTCCACTCACAGGGTCTAGTGGAGAGATCAGG
AAGAATTGCAGAGTTGTTAATTCTTAA

Retrieve as FASTA