Entry information : MePrx137 (cassava4.1_032882m)
Entry ID 9094
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-25 (Christophe Dunand)
Peroxidase information: MePrx137 (cassava4.1_032882m)
Name (synonym) MePrx137 (cassava4.1_032882m)
Class Class III peroxidase    [Orthogroup: Prx189]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx137
start..stop
S start..stop
MePrx125 558 0 1..351 1..350
MePrx13 487 2e-174 1..351 1..350
MePrx100 474 3e-169 1..351 1..350
MePrx87 417 6e-147 37..352 33..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 872250..872507 258 N° 2 872597..872779 183 N° 3 872861..873475 615  
join(872250..872507,872597..872779,872861..873475)


exon

Literature and cross-references MePrx137 (cassava4.1_032882m)
DNA ref. Phytozome 12:   scaffold06814 (872250..873475)
Protein sequence: MePrx137 (cassava4.1_032882m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (330)
PWM (Da):   %s   38338.55 (36044.3)  
PI (pH):   %s   6.24 (5.96) Peptide Signal:   %s   cut: 23 range:23-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAKSFITLLLFISLLSLASCLSSASETKFKANVTVSNGLAFGFYAFVCPQVEILVRNHLLQVFNRDVGQAAGILRLHAHDCFVQGCDGSILLDRSVERTELPNLSLRPESIQVIDTLRQIVHSQCGPVVSCSDLLTLAARDSVFFTSGFDYAVPLGRRDGVVFPRPGQTFEDLIAPNAKTTEVLTKYARKGLNLVDAVALSGAHSIGIAHCSSFSERIFPNRDPTMEISFFNSLRQVCPAPNANGIASLDIRSPFRFDNFYFIDLMNRQGVFTSDQDLFEDLRTRPTVITFAASQPLFFSSFAVAMTKMGSVEVLTGAQGEIRARCNVRNSDVNDLEPVVEKDIASSSAM

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCTAAATCTTTCATCACTCTTCTCCTTTTCATCTCTCTTCTCTCACTGGCTTCTTGCCTTAGCAGTGCTAGTGAGACAAAATTCAAAGCTAATGTTACTGTATCAAACGGC
CTGGCGTTTGGATTCTACGCATTTGTATGTCCTCAAGTTGAAATTCTTGTGAGAAATCATCTGTTGCAAGTTTTCAACAGGGACGTGGGGCAAGCAGCTGGAATCCTTCGTTTACACGCC
CATGACTGCTTTGTTCAG
GTGAAACTCTTTGTGATCTCTAGCATTTGCTGTTTCAGAAATCATTATTGTATTATTAATTGTGGAGGTGCATGAATGAAATTAAACAGGGATGCGATGGAT
CTATATTGCTGGATAGATCAGTTGAGAGGACTGAACTTCCTAACTTGAGCTTGAGACCTGAGTCAATTCAGGTTATTGATACTCTCCGCCAGATTGTTCACTCCCAGTGTGGCCCTGTCG
TCTCTTGTTCTGATCTTCTCACACTCGCTGCGAGGGACTCCGTCTTCTTT
GTAACTGGCTAATCCTTTCCTCTTTTCCTCTTTTCTTCCTTTCTTTTGGAAGAATTTTAATTATAGTTAT
TATTATTACAGACAAGTGGATTTGACTACGCAGTCCCTTTAGGAAGGCGAGATGGAGTAGTGTTCCCAAGACCAGGACAAACATTTGAAGATCTGATAGCTCCTAATGCTAAAACAACTG
AAGTACTAACCAAGTATGCTCGAAAAGGCTTGAATTTAGTCGACGCTGTAGCCCTGTCGGGTGCCCACAGCATCGGTATCGCCCATTGCAGCTCTTTCAGTGAACGCATTTTCCCTAATA
GAGATCCCACCATGGAAATTTCTTTCTTCAATAGTCTTAGGCAAGTTTGTCCTGCACCAAATGCCAATGGCATAGCTTCGTTGGATATTCGATCCCCTTTTAGATTCGACAACTTTTATT
TCATTGATCTAATGAACCGACAGGGAGTGTTTACTTCAGACCAAGATTTGTTTGAAGATCTTAGGACGAGGCCAACTGTTATTACTTTTGCTGCTAGCCAACCTTTGTTCTTCTCGAGCT
TCGCAGTTGCCATGACCAAGATGGGGAGTGTGGAGGTTTTGACAGGCGCACAAGGGGAAATTCGTGCCAGGTGCAACGTAAGGAACTCCGATGTTAACGATTTGGAGCCTGTAGTGGAAA
AGGATATAGCTTCATCCTCTGCAATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTGCTAAATCTTTCATCACTCTTCTCCTTTTCATCTCTCTTCTCTCACTGGCTTCTTGCCTTAGCAGTGCTAGTGAGACAAAATTCAAAGCTAATGTTACTGTATCAAACGGC
CTGGCGTTTGGATTCTACGCATTTGTATGTCCTCAAGTTGAAATTCTTGTGAGAAATCATCTGTTGCAAGTTTTCAACAGGGACGTGGGGCAAGCAGCTGGAATCCTTCGTTTACACGCC
CATGACTGCTTTGTTCAG
GGATGCGATGGATCTATATTGCTGGATAGATCAGTTGAGAGGACTGAACTTCCTAACTTGAGCTTGAGACCTGAGTCAATTCAGGTTATTGATACTCTCCGC
CAGATTGTTCACTCCCAGTGTGGCCCTGTCGTCTCTTGTTCTGATCTTCTCACACTCGCTGCGAGGGACTCCGTCTTCTTT
ACAAGTGGATTTGACTACGCAGTCCCTTTAGGAAGGCGA
GATGGAGTAGTGTTCCCAAGACCAGGACAAACATTTGAAGATCTGATAGCTCCTAATGCTAAAACAACTGAAGTACTAACCAAGTATGCTCGAAAAGGCTTGAATTTAGTCGACGCTGTA
GCCCTGTCGGGTGCCCACAGCATCGGTATCGCCCATTGCAGCTCTTTCAGTGAACGCATTTTCCCTAATAGAGATCCCACCATGGAAATTTCTTTCTTCAATAGTCTTAGGCAAGTTTGT
CCTGCACCAAATGCCAATGGCATAGCTTCGTTGGATATTCGATCCCCTTTTAGATTCGACAACTTTTATTTCATTGATCTAATGAACCGACAGGGAGTGTTTACTTCAGACCAAGATTTG
TTTGAAGATCTTAGGACGAGGCCAACTGTTATTACTTTTGCTGCTAGCCAACCTTTGTTCTTCTCGAGCTTCGCAGTTGCCATGACCAAGATGGGGAGTGTGGAGGTTTTGACAGGCGCA
CAAGGGGAAATTCGTGCCAGGTGCAACGTAAGGAACTCCGATGTTAACGATTTGGAGCCTGTAGTGGAAAAGGATATAGCTTCATCCTCTGCAATG

Retrieve as FASTA