Entry information : MePrx139 (cassava4.1_033971m)
Entry ID 9096
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx139 (cassava4.1_033971m)
Name (synonym) MePrx139 (cassava4.1_033971m)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx139
start..stop
S start..stop
PtPrx73 487 2.72e-175 1..321 1..317
GrPrx38 484 3.2e-174 14..321 12..323
GhPrx38 481 7.24e-173 14..321 12..323
EguPrx23 479 2.66e-172 26..321 21..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9096' 'join(274577..274807,275795..275977,276057..276222,276315..276697)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 274577..274807 229 N° 2 275795..275977 181 N° 3 276057..276222 164 N° 4 276315..276697 381
join(274577..274807,275795..275977,276057..276222,276315..276697)


exon

Literature and cross-references MePrx139 (cassava4.1_033971m)
DNA ref. Phytozome 12:   scaffold03718 (274577..276697)
Protein sequence: MePrx139 (cassava4.1_033971m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (307)
PWM (Da):   %s   33667.66 (31794.9) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.14 (8.57) Peptide Signal:   %s   cut: 18 range:18-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASFYSSSPILTTFKFLIGSFCFLVGIASSQLSSNFYSTTCPTAL
STIKSAVNSAVSSEARMGASLLRLHFHDCFVN
GCDASVLLDGASGEKTAPPNNNSLRGFEVVDSIKSQLESSCPGVVSCADILAVAARDSVVALGGLTWTVQLGRRDSATASFSAASTNIPSPFSDLSVLISDFSGKGFTTKEMVALSGAHT
IGQARCTVFRSRIYNETNIDASFATSLKAKCPSSGGDDNLAPFDITTPKAFDNAYFKNLLSQKGLLHSDQQLFNGGSTDSQVRAYSSNPKLFSTDFANAMVKMGNLSPLTGTSGQIRANC
RKA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTTCTATTCTTCCTCTCCTATTCTCACAACCTTTAAATTCCTCATAGGGTCATTTTGTTTTCTTGTTGGAATCGCCTCTTCTCAGTTATCTTCTAATTTCTATTCAACAACA
TGCCCTACTGCCCTCTCCACCATTAAATCAGCTGTGAACTCTGCTGTATCCAGTGAGGCTCGTATGGGGGCATCATTGCTTCGTCTTCATTTTCATGACTGCTTCGTTAAT
ATGCAAGTC
TCTTTTACTTATCACCATTTCTTCATTTATCTTGCACATTGTTGCATGTGATGCATGTGATGCATGTAATAAGAGATTAAGAACAAACTCTAAAATCCCATTTCTGAAATATTTCGAAGT
GTTAGTTTGATATATGCATGGTTGGTGTTTCTCAGAATACTCCATTTTCTCTTCTGTAGCCAGGTTTCGCTGGTTTCAGTAAAAATTTCAATAGTTTTTATGATTCATCAACTATACATA
GCGGGCTGAAACTTTTGCCAAAGGGCTGAAAAAAATTTTCAATATATTTTTTTCCTATCCATTGGGAAGGACCTTTTCAAGACTTTGCTTCAATATGATTGTGGATTGGAAGAAGACTGA
TATTTTCTGATCTTATTGAAGTCTGTTTGTTAAATTTCACAACTCAGCTATGCATGCTTTCATGGAATTTTTGGTGCATCTAAAATATCATTATATATAATTTGATTCTATATGTGATTA
AGAGAAAAAAATATTTCATTACCAGTAATTTTGACTTTGATTACAGCCTAATTAAACTTATTATTATGATTTGAAAATCCCAGAAGCCAAAAAGAAAGATTAACAAACTGCCGTCTGGTA
TAGGAACACAATGATGCCGACATTATTGACTTTCTTCCATTATATGATTTCTGCTAATAATCTCTCCTTTCCATTATTACGTACAAACATGAATCTTTTGTCCTTTTGCATGGTTTTATT
ATCACGTCTCCTTCAACTTCAGCCTTCTTTTCAATTGTGTTGAAAATGATCTAATGGGAATCACACGATCAAGACAACCACAAAGAAGCATTCGTAATCACTTTAATTAGATTGCATAAC
GAAACTAAGACATTATAGTCTTATACATGTCAATCAGAAGTGTGAACTCATATATTTAGTCATGCATAATTGTGTTGAATTATATCGTATCTGAGCNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNGAGCAGGGATGTGATGCATCAGTGCTGTTGGATGGAGCGTCAGGAGAGAAGACAGCACCCCCTAATAATAATTCTCTAAGGGGATTTGAAGTTGTTGATTCAATTA
AGTCCCAGTTGGAGAGTTCATGCCCTGGAGTGGTTTCCTGCGCAGACATCCTAGCCGTTGCTGCTAGAGACTCTGTTGTTGCT
CTGTAAGAACTTAAATTACCATAACGACTTGTTGTTT
GACTTCCAAGGTTATGGCTGACATAATTCTTGGATTTCTTTCAGTTGGGTGGGCTTACTTGGACGGTTCAATTAGGCAGAAGAGATTCAGCCACAGCAAGCTTTAGTGCTGCATCTACCA
ACATACCTTCTCCATTTTCAGATCTTAGTGTTCTCATCTCTGATTTCTCCGGCAAAGGTTTCACTACTAAAGAAATGGTGGCTCTCTCAG
AGGTGTGTGAATCTCAGAACATCTAGCCAA
AAAACCATCAAATATTTGAAAAATAACGAGTTTTTTGTTTTTTTCTTGAATATTGTTGTTGCAGGAGCTCATACAATTGGGCAAGCGAGATGCACAGTATTTCGCAGCAGGATTTACAAT
GAAACCAACATAGATGCTTCCTTTGCAACGTCGCTAAAAGCTAAATGTCCTAGCTCTGGAGGAGACGATAATCTTGCTCCTTTTGATATCACTACTCCAAAGGCTTTTGATAATGCTTAT
TTCAAGAATTTGTTAAGCCAAAAGGGACTCCTCCACTCTGATCAACAGCTCTTTAATGGAGGTTCTACAGACTCTCAAGTCAGAGCTTATAGCTCCAATCCAAAATTATTCAGTACAGAT
TTTGCCAATGCGATGGTGAAGATGGGAAATCTTAGTCCACTTACAGGCACAAGTGGCCAGATCAGGGCCAACTGTAGGAAAGCCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTTCTATTCTTCCTCTCCTATTCTCACAACCTTTAAATTCCTCATAGGGTCATTTTGTTTTCTTGTTGGAATCGCCTCTTCTCAGTTATCTTCTAATTTCTATTCAACAACA
TGCCCTACTGCCCTCTCCACCATTAAATCAGCTGTGAACTCTGCTGTATCCAGTGAGGCTCGTATGGGGGCATCATTGCTTCGTCTTCATTTTCATGACTGCTTCGTTAAT
GGATGTGAT
GCATCAGTGCTGTTGGATGGAGCGTCAGGAGAGAAGACAGCACCCCCTAATAATAATTCTCTAAGGGGATTTGAAGTTGTTGATTCAATTAAGTCCCAGTTGGAGAGTTCATGCCCTGGA
GTGGTTTCCTGCGCAGACATCCTAGCCGTTGCTGCTAGAGACTCTGTTGTTGCT
TTGGGTGGGCTTACTTGGACGGTTCAATTAGGCAGAAGAGATTCAGCCACAGCAAGCTTTAGTGCT
GCATCTACCAACATACCTTCTCCATTTTCAGATCTTAGTGTTCTCATCTCTGATTTCTCCGGCAAAGGTTTCACTACTAAAGAAATGGTGGCTCTCTCAG
GAGCTCATACAATTGGGCAA
GCGAGATGCACAGTATTTCGCAGCAGGATTTACAATGAAACCAACATAGATGCTTCCTTTGCAACGTCGCTAAAAGCTAAATGTCCTAGCTCTGGAGGAGACGATAATCTTGCTCCTTTT
GATATCACTACTCCAAAGGCTTTTGATAATGCTTATTTCAAGAATTTGTTAAGCCAAAAGGGACTCCTCCACTCTGATCAACAGCTCTTTAATGGAGGTTCTACAGACTCTCAAGTCAGA
GCTTATAGCTCCAATCCAAAATTATTCAGTACAGATTTTGCCAATGCGATGGTGAAGATGGGAAATCTTAGTCCACTTACAGGCACAAGTGGCCAGATCAGGGCCAACTGTAGGAAAGCC
AAT

Retrieve as FASTA