Entry information : MePrx16 ( cassava4.1_011305m)
Entry ID 9098
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2016-02-24 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-24 (Achraf Jemmat)
Peroxidase information: MePrx16 ( cassava4.1_011305m)
Name (synonym) MePrx16 ( cassava4.1_011305m)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx16
start..stop
S start..stop
MePrx70 641 0 11..350 1..340
MePrx115 577 0 5..350 1..343
HbPrx01 523 0 5..350 1..346
MePrx57 474 4e-169 7..348 10..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 528873..529106 234 N° 2 529226..529417 192 N° 3 529618..529786 169 N° 4 529952..530406 455
join(528873..529106,529226..529417,529618..529786,529952..530406)


exon

Literature and cross-references MePrx16 ( cassava4.1_011305m)
DNA ref. Phytozome 12:   scaffold03542 (528777..530406)
Protein sequence: MePrx16 ( cassava4.1_011305m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (324)
PWM (Da):   %s   37350.82 (34555.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.83 (4.61) Peptide Signal:   %s   cut: 27 range:27-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRKTMHSSPLMLVLIALCAILIESSGGLANAQLSPAFYDESCPFASDIIRVVIAEALQTDARIGASLIRLHFHDCFVQGCDASVLLDNSDTILSEKEALPNNNSLRGFDVVDKMKAWLEYACPGVVSCADILAIAAQESVALSGGPIWRSLLGRRDSRTANRSLANTNLPGPFLPLQGLKAAFIAIGLNDNTDLVALSGAHTFGRAQCGGFIHRLYNFNNTGLPDPTLNTTYLQILRKLCPQGGNTTVLANFDPTTPDTFDNDYYSNLLIGEGLLQTDQELFSTPGADTAKIVKNFSANQTAFFESFVVSMIRMGNLNVSTGTAGEVRLNCRIVNGDSSSGADTLLVSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAAGACGATGCATTCCTCTCCATTGATGTTGGTGCTGATAGCTTTATGTGCAATTCTGATTGAATCATCAGGAGGCTTGGCCAATGCTCAGCTATCTCCAGCATTTTATGATGAA
AGCTGCCCATTTGCCTCCGACATTATTCGTGTAGTCATCGCAGAAGCCTTGCAAACTGATGCAAGGATTGGTGCCAGCCTCATCAGGCTTCACTTCCATGACTGCTTTGTTCAA
GTAAAC
TTCAATAATCATCATCTTTTTTTTCTCTTCTTTTATTTATTGTTTCTGTGATCTTAGATGAGGCCTTGATTTCATTAATGAGGAGTTCAAATGTTGTGTTGATATTGTAACAGGGTTGTG
ATGCCTCAGTTTTGCTGGACAACAGTGACACTATATTGAGCGAGAAGGAAGCTCTTCCCAATAATAACTCACTCAGAGGGTTTGATGTTGTTGATAAAATGAAGGCTTGGTTGGAGTATG
CGTGTCCTGGCGTTGTTTCTTGTGCTGATATTCTCGCCATTGCAGCTCAAGAATCTGTTGCTTTG
GTAATGTTTTCTTTCATTATGTTTTCTTTTTTTCCAATAAGAAATTGAATTTTAT
TACATCGAATTGCCTTGGGAGGGAAGAAAAGGCCCATTCAAGAAAAATTTAACATGAACATGTTGAGTAAATCTAAGTCGATAGCGATGGTGATGATTGACCAATGTATGTAATAATGAT
GGAGTTGATGGCTAGCTATATGCAGTCAGGAGGGCCAATATGGAGAAGTTTACTTGGAAGGAGAGATAGCAGAACAGCAAACAGAAGTCTAGCTAATACAAACCTTCCAGGTCCCTTCTT
GCCCCTCCAGGGTCTCAAGGCCGCCTTCATCGCCATCGGCCTCAACGACAACACTGATCTAGTTGCCCTATCAG
GTAATTTTCAATTATTCTTTTTTCAAATAATACTCTCTAATAACTC
ATTGCAAAAACTCTTAATGCCACTGGATGCAAATTTTTAATTTTCATTTCAATGTTGATAATTGGTAATATAAAACTATTGTAATTATATTGAATAAACTTTTCCTTGGCATTGATCAGG
TGCTCATACATTTGGAAGAGCTCAATGTGGAGGATTTATCCACCGTTTATACAACTTCAATAACACTGGTCTTCCAGACCCAACGTTGAACACAACTTATTTGCAAATTCTCCGAAAACT
ATGTCCCCAAGGAGGAAATACCACTGTATTAGCTAATTTCGATCCCACAACTCCAGATACTTTTGACAATGATTATTACTCAAATCTTCTAATTGGAGAAGGCCTTCTTCAGACTGACCA
AGAACTATTTTCAACTCCTGGAGCTGATACTGCTAAAATTGTTAAAAATTTTAGTGCTAACCAGACTGCTTTCTTTGAAAGCTTTGTGGTGTCAATGATCAGAATGGGAAATCTCAACGT
CTCAACAGGAACTGCTGGAGAAGTTAGGTTGAATTGTAGGATAGTTAATGGAGATTCATCAAGCGGAGCAGACACTCTTCTCGTTAGCTCCATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAAGACGATGCATTCCTCTCCATTGATGTTGGTGCTGATAGCTTTATGTGCAATTCTGATTGAATCATCAGGAGGCTTGGCCAATGCTCAGCTATCTCCAGCATTTTATGATGAA
AGCTGCCCATTTGCCTCCGACATTATTCGTGTAGTCATCGCAGAAGCCTTGCAAACTGATGCAAGGATTGGTGCCAGCCTCATCAGGCTTCACTTCCATGACTGCTTTGTTCAA
GGTTGT
GATGCCTCAGTTTTGCTGGACAACAGTGACACTATATTGAGCGAGAAGGAAGCTCTTCCCAATAATAACTCACTCAGAGGGTTTGATGTTGTTGATAAAATGAAGGCTTGGTTGGAGTAT
GCGTGTCCTGGCGTTGTTTCTTGTGCTGATATTCTCGCCATTGCAGCTCAAGAATCTGTTGCTTTG
TCAGGAGGGCCAATATGGAGAAGTTTACTTGGAAGGAGAGATAGCAGAACAGCA
AACAGAAGTCTAGCTAATACAAACCTTCCAGGTCCCTTCTTGCCCCTCCAGGGTCTCAAGGCCGCCTTCATCGCCATCGGCCTCAACGACAACACTGATCTAGTTGCCCTATCAG
GTGCT
CATACATTTGGAAGAGCTCAATGTGGAGGATTTATCCACCGTTTATACAACTTCAATAACACTGGTCTTCCAGACCCAACGTTGAACACAACTTATTTGCAAATTCTCCGAAAACTATGT
CCCCAAGGAGGAAATACCACTGTATTAGCTAATTTCGATCCCACAACTCCAGATACTTTTGACAATGATTATTACTCAAATCTTCTAATTGGAGAAGGCCTTCTTCAGACTGACCAAGAA
CTATTTTCAACTCCTGGAGCTGATACTGCTAAAATTGTTAAAAATTTTAGTGCTAACCAGACTGCTTTCTTTGAAAGCTTTGTGGTGTCAATGATCAGAATGGGAAATCTCAACGTCTCA
ACAGGAACTGCTGGAGAAGTTAGGTTGAATTGTAGGATAGTTAATGGAGATTCATCAAGCGGAGCAGACACTCTTCTCGTTAGCTCCATG

Retrieve as FASTA