Entry information : MePrx22 (cassava4.1_011704m)
Entry ID 9101
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: MePrx22 (cassava4.1_011704m)
Name (synonym) MePrx22 (cassava4.1_011704m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx22
start..stop
S start..stop
MePrx63 575 0 1..328 1..327
RcPrx30 572 0 1..328 1..329
TcPrx17 554 0 12..324 13..323
PtPrx35 555 0 1..328 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 290793..290987 195 N° 2 291108..291299 192 N° 3 291665..292261 597  
join(290793..290987,291108..291299,291665..292261)


exon

Literature and cross-references MePrx22 (cassava4.1_011704m)
Literature Hearne,S.J., Town,C.D., Moskal,W.A. Jr., Zhuang,J., Viswanathan ,L.D., Kriga,Y., Shatsman,S., Shetty,J. and Ferguson,M.E. ESTs from drought stressed and non-stressed leaves, shoot meristem and roots of drought tolerant and drought sensitive cassava cultivars
DNA ref. Phytozome 12:   scaffold02559 (290793..292261)
EST ref. GenBank:   FF380837.1 [3' end]
Protein sequence: MePrx22 (cassava4.1_011704m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (311)
PWM (Da):   %s   36079.8 (34267.9)  
PI (pH):   %s   4.44 (4.44) Peptide Signal:   %s   cut: 18 range:18-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLYTAFLLLMAMASATPLWPGFYSETCSDAELIVREVMKKAMIREPRSVASVMRFQFHDCFVNGCDASLLLDDTPTMLGEKLALSNINSLRSFDVVDEVKEELEKVCPGTVSCADIIIMAARDAVALSGGPDWEVKLGRKDSLTASQEDSDNIMPSPRANASLLIDLFASFDLSIKDLVALSGSHSIGQGRCFSIMFRLYNQSGTGKPDPTIESSFREKLDNLCPVGGNENVTGDLDSTPIVFDNIYFKDLVAGRGFLNSDQTLYTFPETRDYVELFSKDQQAFFDAFVEGMIKMGDLQSGRPGEIRTNCRVVNTHHRPVDVLLET

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 2 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCAACCAAAA CCAACTGAAT TTATTATCCA AAAAAAAAAT AATCTTATGG CATTTTTAGT CTAACAAATC ACATAGTTCT GACGCTCATT GCAACCGGCA CGCGACCGGC ACACTACTCC  TTGAAAGATG TTCTACAACA CTCGCAAAAC CAAAATCAGA AAATTCAAAA TCGAAAAAAC CAAAATCGAC ATGCCGTACA CCAATCGGGC GAGGCACACT GTGTCAGGTG TCAGCAGGAA  GAAAAAGGAG GTGGGAAATT GTATCTTTGT TTCCCCAGAC TGGACACTAA GGATTAGGAT AGGCCTAAAT TATAGAAATG ATCTTTGAAG TCTACACCAC CTCATTGGCT AACCGCTGAC  CCAATTAACA TTTTTTTCTG CTCTCTCTTC CCCACTGCGC TTTCTCCAAA ATGCCCATGC CTCTCTCACT TCTAGTTCTA TGTTCACAGG AGACATCTCT CATTCCTCAT GAGGATTCAT  TCTCTTCATC GCCCTCAATT TAGAGCCGGG ATAAATCAGT TAAAAAATTT AAAGATTTTT AAATAGTTTA AAAATTATTT CCGTTTAATT AATATTTTTA TTTAATTTTT TAAAAAATCG  AGAATTTTTC TTCTTTGAAC GGAGAATAAG AAATGAATTT TAAAAAATAA TAATACTTTG AATTTGTTAA ATATATTTGA ATGATTGATA AAAAAGAAAT CATAAATATA TTTTATTTCC  CCCTGGGACT AAATATCTCC TTTTTTGACT TTCTTAATAG GCTAAGAATT CAAGAAAAGG AAAGAGGGGA AGTCTGTTTG TGGGTGGTCC AAACTTTCTT GCATTAAAGC ACAGGATATG  CATGAATTTC TTTATATCTC TGTACTTCAA CATTGTCAGT GATATTGACA TATTAAAAAA GGTTTCTTTC CCTGCACTTA ATTGCATAGC AACTATAATT GAAACCGTCG AATAATCAGA  GACCTAAGGC GCTGGCAGGG GCCAATGGTT TCTTCTAAAA TTTAAACTTT TAACCGTAGA ATGAATATGA ATTTATTTGT AATAAATTCA CATATTTCCC TCTAAAATTT TTAAAAAATT  TTATTTATCA GCTTAAATAA TAATTTAATG AGTTAAAATT TAATATATTT TAAAAATAAA TGTTTCATTC ATCACAGTTG CCAAGACTGG CCATAACCTT ACTACTACTC CTTATTAAGC  TAAACACACT ACCTCATACT TCTGCATCAT TATTAATCAC TCATTCCACT TAAAAGAAAC AATTCTAGCC CACTTGATAG CTGTCATATA TTTTGAAAGT GCAATTGCAA AATGGGTATT  ATAGAAAGTG AGTGAGCTCA TATTCCTCAT TTGACAAAGT AAAAATTTGC AAAATTTGCT TAGAAGTGTC ATAAGTTATA TAATTATTTA TTCTTTATTC AAAAAATACA TTGCATAACA  GTCGGTTTAA AGAGGAGAAT AATAATTTCG TTTTAAGAGG AAAATTTATA TATTTTAATT AGTGTATTTG TAATTTATAT TATTTTTATA TTAATATTAT AAAACCATGC TAATTACATT  TTAAATAATT GAAGTATATC ATAAGAACGC GTGCAAATTG CCACAAAACT TTTCTGAGAA AGTTCTAGTC CAGTATTTAC AAACAACACT TGCATTTCCC AGAGTAAATA TCACCTCTCA  TCTCTCTAGA AGGAGCAGAA CAACATGGAA CTATTTCCAA TGATATTCCT CTCAAACCCA CAATCCCAAT TGGCCAGAAC ATAGACACCT ATTCTCCAAA AAATAAACCT GTAATCTGTT  GACACCCAGA AAAGGCATCT AATACCTTCC TATACCCATC ATCATCATCA CTACATGACA TAGCATCCAT CCATGTATGG TAAGTTTCTA TCCATCACAT ACACATACAT CCATCCATCC 
ATCAATCCAA GAAGCTTATA AGCCCATAAA AAGCACCAAA ATTAGACCAC ATCTCATACA CTGTCAACTA CTGCCCAAAA C 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTTTATACAGCCTTTCTCCTGCTGATGGCCATGGCCTCTGCAACGCCACTATGGCCAGGATTCTACTCTGAGACATGCTCTGATGCTGAATTGATAGTGAGGGAAGTGATG
AAAAAGGCCATGATCAGAGAACCAAGAAGCGTTGCCTCTGTTATGCGTTTTCAATTCCATGATTGCTTTGTTAAT
GTAAAAACTCTATTACTTTTTTTTATTTATTTATCAATTAAGATC
TTTAATCAGTGTTTCTTGATTTGATCTGATTTGATTTTTACAATTCCGATTCTTGTTTTGCATTTCTTGTAAAAGGGTTGTGATGCTTCTTTGTTGCTGGATGATACACCAACCATGCTG
GGAGAGAAGCTGGCTCTTTCCAATATAAATTCTCTAAGGTCTTTTGACGTTGTCGACGAAGTCAAGGAAGAGCTAGAGAAGGTCTGTCCAGGAACCGTTTCTTGTGCAGATATAATTATC
ATGGCTGCTAGAGATGCTGTTGCTCTG
GTAATTGATTTTTTTTCTTGATAACTTTGTCCTTTGGTTGTTTTTCTCTCTCTCTCTTTCTCTAGAACCAATCAACTTGACCCATAACACAGA
CTATTGGGCCTTTAGCTATTGAGGATATTAATTCTGTGATATGGGTCCTGGTTGTCCAACTTTTATCAGCCAGTCAATTATCACAACATTAAAAGGGTAGGCTCTATGCAAAAATAGTGC
CTAGTTTACAACTTGCCAATGAGGCCACCCTTTTACCTATTCCATCTATGGAAAATGGTTTGATGAATCCCACATTGGATCATTAGTTGTTTTTGTTGATTGTTGTCTGAAAATGGGTTA
TCTTTGTTCTGTCAATTTGTCTTGTGTACCAGAGTGGAGGACCTGATTGGGAGGTGAAGTTAGGGAGAAAAGATAGCTTGACAGCAAGCCAAGAAGACTCGGACAATATCATGCCAAGTC
CAAGAGCCAATGCGAGCCTTCTCATAGACCTCTTTGCAAGCTTCGATCTCTCTATCAAAGATCTTGTAGCCCTTTCAGGGTCACATTCCATTGGACAAGGTAGATGTTTCTCTATAATGT
TTAGACTCTACAATCAATCTGGAACAGGCAAGCCAGACCCAACCATCGAGTCAAGCTTCAGAGAAAAACTAGACAACCTGTGTCCAGTTGGTGGAAATGAAAATGTGACAGGAGACCTTG
ATTCAACACCAATTGTGTTTGACAATATATATTTCAAGGACTTGGTTGCAGGGAGAGGGTTTCTGAATTCTGATCAAACACTTTACACATTTCCTGAAACAAGAGACTATGTGGAATTGT
TTAGCAAAGATCAACAAGCTTTTTTCGATGCCTTTGTTGAGGGAATGATAAAGATGGGTGATTTGCAATCTGGAAGGCCTGGAGAAATCAGAACCAATTGCAGAGTGGTCAACACCCACC
ACCGCCCTGTTGATGTTCTGCTGGAGACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTTTATACAGCCTTTCTCCTGCTGATGGCCATGGCCTCTGCAACGCCACTATGGCCAGGATTCTACTCTGAGACATGCTCTGATGCTGAATTGATAGTGAGGGAAGTGATG
AAAAAGGCCATGATCAGAGAACCAAGAAGCGTTGCCTCTGTTATGCGTTTTCAATTCCATGATTGCTTTGTTAAT
GGTTGTGATGCTTCTTTGTTGCTGGATGATACACCAACCATGCTG
GGAGAGAAGCTGGCTCTTTCCAATATAAATTCTCTAAGGTCTTTTGACGTTGTCGACGAAGTCAAGGAAGAGCTAGAGAAGGTCTGTCCAGGAACCGTTTCTTGTGCAGATATAATTATC
ATGGCTGCTAGAGATGCTGTTGCTCTG
AGTGGAGGACCTGATTGGGAGGTGAAGTTAGGGAGAAAAGATAGCTTGACAGCAAGCCAAGAAGACTCGGACAATATCATGCCAAGTCCAAGA
GCCAATGCGAGCCTTCTCATAGACCTCTTTGCAAGCTTCGATCTCTCTATCAAAGATCTTGTAGCCCTTTCAGGGTCACATTCCATTGGACAAGGTAGATGTTTCTCTATAATGTTTAGA
CTCTACAATCAATCTGGAACAGGCAAGCCAGACCCAACCATCGAGTCAAGCTTCAGAGAAAAACTAGACAACCTGTGTCCAGTTGGTGGAAATGAAAATGTGACAGGAGACCTTGATTCA
ACACCAATTGTGTTTGACAATATATATTTCAAGGACTTGGTTGCAGGGAGAGGGTTTCTGAATTCTGATCAAACACTTTACACATTTCCTGAAACAAGAGACTATGTGGAATTGTTTAGC
AAAGATCAACAAGCTTTTTTCGATGCCTTTGTTGAGGGAATGATAAAGATGGGTGATTTGCAATCTGGAAGGCCTGGAGAAATCAGAACCAATTGCAGAGTGGTCAACACCCACCACCGC
CCTGTTGATGTTCTGCTGGAGACT

Retrieve as FASTA