Entry information : MePrx30 (cassava4.1_011844m)
Entry ID 9109
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx30 (cassava4.1_011844m)
Name (synonym) MePrx30 (cassava4.1_011844m)
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx30
start..stop
S start..stop
CclPrx59 503 0 2..324 4..329
EgrPrx124 493 1e-177 1..324 1..325
PtPrx58 491 5e-177 1..324 1..322
RcPrx22 485 7e-175 1..294 1..295
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129388..129606 219 N° 2 129071..129253 183 N° 3 128825..128990 166 N° 4 128214..128617 404
complement(join(128214..128617,128825..128990,129071..129253,129388..129606))


exon

Literature and cross-references MePrx30 (cassava4.1_011844m)
DNA ref. Phytozome 12:   scaffold03060 (129606..128214)
Protein sequence: MePrx30 (cassava4.1_011844m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (298)
PWM (Da):   %s   35427.5 (32459.9)  
PI (pH):   %s   6.96 (5.77) Peptide Signal:   %s   cut: 27 range:27-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKHNNSYKLSFVHLLCVLLLTPLICSQLDYRFYDDSCPNLTRIVRYGVWSAMSNDTRMAASLLRLHFHDCFVNGCDGSLLLDGENVEKNGLANRNSARGFEAIDNIKANLEKACPATVSCADILAIVAREAVYLTGGPFWNVPLGRRDGLTSSQNAANQQLPSPFESLENITAKFTSKGLDLKDVVVLSGGHTLGFAQCFTFKTRLFNFSGSGKPDPALDTSFLQSLQNACPDQADSDTKLAPFDSTSSKFDNVYYNLLMNNAGLLQSDQALMGDNTAASLVSYYSKFPYMFSKDFGVSMVKMGGIGVLTRQDGEIRKNCRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCATAATAACTCATACAAACTCTCTTTTGTTCACTTGCTTTGTGTTTTACTCTTGACTCCATTGATATGCTCCCAACTTGACTACAGATTCTATGATGATTCTTGTCCTAACCTG
ACAAGAATTGTTCGATATGGTGTTTGGTCAGCCATGTCCAATGATACAAGGATGGCAGCCTCTCTATTGAGGCTTCACTTTCATGATTGTTTTGTTAAT
GTAATCTAATGAATCAATTCC
CTTTTTTCCCCCTTTTTCAAATTTTTTTATAATCCCAAATTTTCTCAATGGTGAGATTATTCTCCTGGGAGTGTGCAAATGACTGCAGACTTTTTGTGTCTTCTGTTATATAGGGATGTG
ACGGATCTCTCCTTCTTGATGGTGAGAATGTGGAGAAAAATGGATTGGCAAATAGAAATTCAGCTCGAGGATTTGAGGCCATTGACAATATTAAAGCTAATTTGGAGAAAGCCTGCCCTG
CCACAGTTTCTTGTGCTGATATACTAGCTATTGTGGCAAGAGAAGCAGTTTATCTT
GTGAGAAATCATACTTGTATTATTTAAATGATCTTTTTTTTTCTTTTTGTTGTTGTTTCTTATT
TGAAGTTTCTTCTCAGACTGGAGGCCCATTCTGGAATGTTCCTTTGGGTCGCAGAGATGGGTTAACATCAAGTCAGAATGCTGCTAATCAACAGCTACCATCACCTTTTGAATCCTTAGA
GAATATCACTGCAAAATTTACCTCAAAGGGTCTTGATTTGAAGGATGTTGTTGTGCTCTCAG
GTTTGGCTTCTACAAGAACTCTACTCGTCCGTTTCTTGCCTTATTGTTATGTTCTCAG
GTAGTAACGAATCTAAAGGGGCAGATAGGGGCTGTCACCCCNNNNNNNNNNNNNNNNNNNNNGGGAGTAGATTAAATATGAATGAAAATACAACGTCCGTCAGTGCTCTCGGGTTCAAAA
ATCNNNNNNNNNNNNNNNNNNNNNNGCAGGTGGACACACACTTGGCTTTGCTCAGTGCTTCACTTTCAAAACAAGGCTCTTCAACTTTAGTGGCTCTGGAAAACCTGATCCTGCACTGGA
CACATCATTTCTGCAAAGTCTGCAAAATGCATGTCCAGACCAAGCAGATTCTGATACAAAATTGGCTCCTTTTGATTCCACTTCTTCAAAGTTTGACAATGTTTATTACAATCTTCTTAT
GAACAATGCTGGGCTTCTCCAATCAGACCAAGCTCTCATGGGGGACAATACGGCTGCTTCACTAGTCAGTTACTACAGCAAGTTCCCTTACATGTTCTCCAAGGATTTCGGAGTATCAAT
GGTCAAGATGGGTGGCATTGGTGTTCTTACAAGACAAGATGGGGAGATCAGAAAAAACTGTAGGGTGAACAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCATAATAACTCATACAAACTCTCTTTTGTTCACTTGCTTTGTGTTTTACTCTTGACTCCATTGATATGCTCCCAACTTGACTACAGATTCTATGATGATTCTTGTCCTAACCTG
ACAAGAATTGTTCGATATGGTGTTTGGTCAGCCATGTCCAATGATACAAGGATGGCAGCCTCTCTATTGAGGCTTCACTTTCATGATTGTTTTGTTAAT
GGATGTGACGGATCTCTCCTT
CTTGATGGTGAGAATGTGGAGAAAAATGGATTGGCAAATAGAAATTCAGCTCGAGGATTTGAGGCCATTGACAATATTAAAGCTAATTTGGAGAAAGCCTGCCCTGCCACAGTTTCTTGT
GCTGATATACTAGCTATTGTGGCAAGAGAAGCAGTTTATCTT
ACTGGAGGCCCATTCTGGAATGTTCCTTTGGGTCGCAGAGATGGGTTAACATCAAGTCAGAATGCTGCTAATCAACAG
CTACCATCACCTTTTGAATCCTTAGAGAATATCACTGCAAAATTTACCTCAAAGGGTCTTGATTTGAAGGATGTTGTTGTGCTCTCAG
GTGGACACACACTTGGCTTTGCTCAGTGCTTC
ACTTTCAAAACAAGGCTCTTCAACTTTAGTGGCTCTGGAAAACCTGATCCTGCACTGGACACATCATTTCTGCAAAGTCTGCAAAATGCATGTCCAGACCAAGCAGATTCTGATACAAAA
TTGGCTCCTTTTGATTCCACTTCTTCAAAGTTTGACAATGTTTATTACAATCTTCTTATGAACAATGCTGGGCTTCTCCAATCAGACCAAGCTCTCATGGGGGACAATACGGCTGCTTCA
CTAGTCAGTTACTACAGCAAGTTCCCTTACATGTTCTCCAAGGATTTCGGAGTATCAATGGTCAAGATGGGTGGCATTGGTGTTCTTACAAGACAAGATGGGGAGATCAGAAAAAACTGT
AGGGTGAACAAC

Retrieve as FASTA