Entry information : MePrx35 ( cassava4.1_012124m)
Entry ID 9114
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-16 (Christophe Dunand)
Peroxidase information: MePrx35 ( cassava4.1_012124m)
Name (synonym) MePrx35 ( cassava4.1_012124m)
Class Class III peroxidase    [Orthogroup: Prx041]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx35
start..stop
S start..stop
MePrx123 524 0 1..316 1..316
CclPrx48 485 7e-175 4..316 7..319
CsPrx07 485 7e-175 4..316 7..319
CppPrx06 485 1e-174 4..316 5..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 116274..116480 207 N° 2 116560..116751 192 N° 3 116865..117030 166 N° 4 117270..117652 383
join(116274..116480,116560..116751,116865..117030,117270..117652)


exon

Literature and cross-references MePrx35 ( cassava4.1_012124m)
DNA ref. Phytozome 12:   scaffold00926 (116274..117652)
Protein sequence: MePrx35 ( cassava4.1_012124m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   34018.25 (31731.1)  
PI (pH):   %s   8.47 (8.54) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASYNLLLFFLVAACAFAVANGKLSPDYYSSMCPKASSIVQKGVVAAIKKETRMGASLLRLHFHDCFVNGCDGSVLLDDNATFIGEKTAVPNNNSIRGFDVIDDIKAKVEKACPGVVSCADIVALAARDSTVYLGGPFWEVELGRRDSLTASRALANTSIPAPTSNLSDQIKSYAAQGLSLKDLVALSGSHTVGLARCTTFRGHIYNDSDIDPCFAKSLQQICPRSGKDSVLAPLDLQTPTCFDNLYYKNLLERKGLLHSDQELFNGNSADSLVRKYASNPSAFFKDFARAMVKMGNIKPLTGSQGEVRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic '3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTACAACCTTCTGTTGTTCTTTCTGGTTGCTGCTTGTGCATTTGCTGTCGCTAATGGCAAGCTATCCCCGGATTATTACTCGTCTATGTGCCCGAAAGCGTCGTCTATTGTT
CAGAAAGGAGTTGTAGCAGCAATAAAGAAGGAAACAAGAATGGGAGCATCTTTGCTCAGATTGCATTTTCATGACTGTTTTGTGAAT
GTGAGCACATGTTTGTTTATACATATGGTTTTG
CTTGTATATTGGTGTTTTTATGGACTAATATTCACTTCATTTGTAGGGCTGCGACGGTTCCGTCCTGTTAGATGATAATGCCACCTTCATAGGGGAGAAAACTGCTGTTCCTAACAATAA
CTCAATTAGAGGATTTGATGTTATTGATGACATTAAAGCTAAGGTAGAAAAAGCTTGTCCTGGCGTTGTGTCCTGTGCTGATATTGTCGCCCTGGCAGCTCGAGACTCGACTGTTTAT
GT
AAGTTATTGCATATTAAGCTCATAAAAGTGTCAAAGTTTCAGCGTTTTTCATGTGGTTACTTTGTCAGAATAGATACTTGAAATGGGTTGATGTTTTTTTGGCAAGTGCAGTTGGGTGGT
CCATTTTGGGAGGTTGAGTTGGGAAGAAGAGATTCTCTCACTGCAAGCAGGGCACTCGCAAATACTTCCATCCCTGCACCTACTTCTAATCTGAGTGATCAGATAAAAAGCTACGCTGCT
CAGGGCCTCTCTTTGAAAGACTTGGTGGCTCTTTCAG
GTGAGGTTTTGTTTAGCCTTCCGTGAACTCACATTACTAATTCTCTTCAAGAAGCATATAGATGAAATGCTCATTTCAAGATG
AAATGCTCATTTCAAGATGAAACTTAGGCGAGAATTAATTAAAAGTTGACTTCAGGTTTTGAGCCAAGACCATCACTTCACTTTTTAAGCTAATACCTAAATTATGATCCTGAAATTTCA
ACAAACACCTTTATAAATTACTCATTTGGATGGCAGGTTCACACACCGTAGGCTTAGCCAGGTGCACAACATTTCGAGGGCACATATACAACGATTCTGATATTGATCCTTGCTTCGCCA
AGTCATTGCAGCAGATATGCCCAAGAAGTGGGAAAGATAGTGTTCTTGCACCCCTTGATCTCCAAACACCAACCTGTTTTGATAATCTGTACTACAAGAACTTGTTGGAACGGAAGGGTC
TTCTCCACTCAGACCAAGAACTCTTCAATGGCAATTCTGCTGATTCCCTAGTTAGAAAATATGCAAGTAACCCTTCTGCCTTTTTCAAGGACTTTGCCAGAGCTATGGTTAAGATGGGCA
ACATTAAGCCCCTCACAGGAAGCCAGGGAGAGGTAAGAAAAAATTGCAGAAAAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTACAACCTTCTGTTGTTCTTTCTGGTTGCTGCTTGTGCATTTGCTGTCGCTAATGGCAAGCTATCCCCGGATTATTACTCGTCTATGTGCCCGAAAGCGTCGTCTATTGTT
CAGAAAGGAGTTGTAGCAGCAATAAAGAAGGAAACAAGAATGGGAGCATCTTTGCTCAGATTGCATTTTCATGACTGTTTTGTGAAT
GGCTGCGACGGTTCCGTCCTGTTAGATGATAAT
GCCACCTTCATAGGGGAGAAAACTGCTGTTCCTAACAATAACTCAATTAGAGGATTTGATGTTATTGATGACATTAAAGCTAAGGTAGAAAAAGCTTGTCCTGGCGTTGTGTCCTGTGCT
GATATTGTCGCCCTGGCAGCTCGAGACTCGACTGTTTAT
TTGGGTGGTCCATTTTGGGAGGTTGAGTTGGGAAGAAGAGATTCTCTCACTGCAAGCAGGGCACTCGCAAATACTTCCATC
CCTGCACCTACTTCTAATCTGAGTGATCAGATAAAAAGCTACGCTGCTCAGGGCCTCTCTTTGAAAGACTTGGTGGCTCTTTCAG
GTTCACACACCGTAGGCTTAGCCAGGTGCACAACA
TTTCGAGGGCACATATACAACGATTCTGATATTGATCCTTGCTTCGCCAAGTCATTGCAGCAGATATGCCCAAGAAGTGGGAAAGATAGTGTTCTTGCACCCCTTGATCTCCAAACACCA
ACCTGTTTTGATAATCTGTACTACAAGAACTTGTTGGAACGGAAGGGTCTTCTCCACTCAGACCAAGAACTCTTCAATGGCAATTCTGCTGATTCCCTAGTTAGAAAATATGCAAGTAAC
CCTTCTGCCTTTTTCAAGGACTTTGCCAGAGCTATGGTTAAGATGGGCAACATTAAGCCCCTCACAGGAAGCCAGGGAGAGGTAAGAAAAAATTGCAGAAAAGTCAAT

Retrieve as FASTA