Entry information : MePrx57 (cassava4.1_021175m)
Entry ID 9117
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx57 (cassava4.1_021175m)
Name (synonym) MePrx57 (cassava4.1_021175m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx57
start..stop
S start..stop
HbPrx01 505 0 13..348 6..344
PalPrx04 480 7e-172 15..348 1..335
PkPrx04 477 2e-170 12..348 4..341
MePrx115 476 2e-170 14..348 8..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16155..16391 237 N° 2 15861..16052 192 N° 3 15492..15660 169 N° 4 14599..15050 452
complement(join(14599..15050,15492..15660,15861..16052,16155..16391))


exon

Literature and cross-references MePrx57 (cassava4.1_021175m)
DNA ref. Phytozome 12:   scaffold06265 (16391..14599)
Protein sequence: MePrx57 (cassava4.1_021175m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (328)
PWM (Da):   %s   37339.52 (35060.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.23 (5.30) Peptide Signal:   %s   cut: 23 range:23-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKSHSRFASSCSLMLVLGLACGLLVGGWLANGQLSPTFYDETCPYASCIIRQVIKQSMQSDPRIGASLIRLHFHDCFVNGCDGSILLDDSPNIESEKEAAANKNSARGFDVVDTIKGRLESICPSTVSCADILTNAAQQSVSLAGGPSWSNLLGRRDSTTANKTLVNINIPSPFDTLGGLKSKFTNVGLNGNTDLVALSGAHTFGRAQCLTFNGRLYNFNNTGVPDPTLNTTYLQRLRQICPQGGNASVIANLELTTPDAFDNNYFSNLLSNQGLLQSDQELFSTTGADTVAIVNHFSANQSAFFESFVKSMIRMGNLSVLTGTHGEIRLNCREVNANSATADSILVSL

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCTCATTCTCGTTTTGCTTCTTCTTGTTCATTAATGCTAGTTTTAGGTTTAGCATGTGGATTACTGGTTGGAGGATGGTTAGCAAATGGGCAGCTGAGTCCAACATTTTACGAC
GAAACTTGCCCATATGCTTCTTGCATCATACGTCAGGTCATCAAGCAATCCATGCAATCTGATCCCAGGATTGGCGCTAGCCTCATCAGGCTTCATTTTCATGACTGCTTTGTTAAT
GTA
ACACTTCTCTTCTCTCTCCCTTCCATCTCCCACTGCTTAATTTTTTCTCTTTTCCATTTGATTTCATACAAAAAAAAAGTGAAACGGGTTTTGTTTCAGGGATGCGATGGATCAATTCTG
TTGGACGACAGTCCTAATATAGAAAGTGAAAAGGAAGCTGCTGCCAATAAAAACTCTGCCAGAGGTTTTGATGTTGTTGATACTATCAAGGGTAGGCTGGAGAGTATCTGTCCTTCCACT
GTTTCTTGTGCTGATATACTCACAAATGCAGCTCAACAATCTGTTTCTTTG
GTAAATATTTCCTGCAATATATTATTTTTCTTTTATCTGATATGGGCAAGTTTCATAGGAAAGGCCAAA
AGTGAGCTAGCTTGATTGTTATACTGATTTTTTTTTTTAGGAAGATTGTTGTACTGATTAATCTTCATGTGTTGATGAATTTCTCAAGTCTTTTTTAGCATAGACTAATGATGTGTTTGT
TTTTTGTGCAGGCAGGAGGTCCCTCGTGGAGTAATCTACTAGGAAGAAGAGACAGCACAACAGCAAACAAAACTCTAGTTAATATTAACATTCCAAGTCCCTTTGACACTCTTGGTGGTC
TCAAATCTAAGTTTACAAATGTAGGCCTCAATGGAAACACTGACCTGGTTGCTCTCTCTG
GTAACCCTTATTTCTTCTCTTTTTCCTACAAAAAAAAGTTTTATTAAAAGGAAAAAAAAT
AAAAGAGAAAGAAGGGTATACAAATGATGCTTCTTTTTGTTATTAATATAGATAAGCTAGGTTGCCTGGCCTAGCTTGATTAGTGAAGAGAAATACCAATACTTGATATAGTATTACTGA
TACTTGATACAGTATTTCACGCAAAAAAATGAATAGATTCATATATAGTTAGCAAAAATTATTAAGTAATTTAATTAATTGGATCAATTAAAAACGAATCTAAAAAGTATTTGGTTCATT
TTAAATTGGATTGGCCACTCAAAGTTAAAAAAATTACACAGAACTATGCAAAGAAAGGGCTACCGTGGAGCCGATTCAACATATGTGACGAGAAGGTCACAAAATTCATTTTGGCGCTAA
TGGCTTTTTCTCTCATTTTAGGTGCTCACACTTTTGGAAGAGCTCAGTGTTTAACTTTCAATGGTAGATTATACAACTTCAACAACACTGGTGTTCCAGACCCAACACTGAACACAACTT
ATCTGCAAAGACTTCGCCAAATATGCCCACAAGGTGGAAATGCAAGTGTCATAGCCAATCTTGAATTGACAACACCTGATGCATTTGACAATAACTATTTCTCTAATCTTCTATCAAACC
AAGGCCTCCTCCAGAGCGATCAGGAACTATTTTCAACTACTGGGGCTGATACTGTCGCCATTGTCAACCACTTCAGTGCTAATCAGAGTGCTTTCTTTGAAAGCTTTGTGAAATCCATGA
TCAGAATGGGAAATCTTAGTGTTTTAACAGGAACTCATGGGGAGATCAGGTTGAATTGCAGAGAAGTTAATGCGAATTCAGCTACAGCAGATAGTATTCTTGTGAGCTTAATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAATCTCATTCTCGTTTTGCTTCTTCTTGTTCATTAATGCTAGTTTTAGGTTTAGCATGTGGATTACTGGTTGGAGGATGGTTAGCAAATGGGCAGCTGAGTCCAACATTTTACGAC
GAAACTTGCCCATATGCTTCTTGCATCATACGTCAGGTCATCAAGCAATCCATGCAATCTGATCCCAGGATTGGCGCTAGCCTCATCAGGCTTCATTTTCATGACTGCTTTGTTAAT
GGA
TGCGATGGATCAATTCTGTTGGACGACAGTCCTAATATAGAAAGTGAAAAGGAAGCTGCTGCCAATAAAAACTCTGCCAGAGGTTTTGATGTTGTTGATACTATCAAGGGTAGGCTGGAG
AGTATCTGTCCTTCCACTGTTTCTTGTGCTGATATACTCACAAATGCAGCTCAACAATCTGTTTCTTTG
GCAGGAGGTCCCTCGTGGAGTAATCTACTAGGAAGAAGAGACAGCACAACA
GCAAACAAAACTCTAGTTAATATTAACATTCCAAGTCCCTTTGACACTCTTGGTGGTCTCAAATCTAAGTTTACAAATGTAGGCCTCAATGGAAACACTGACCTGGTTGCTCTCTCTG
GT
GCTCACACTTTTGGAAGAGCTCAGTGTTTAACTTTCAATGGTAGATTATACAACTTCAACAACACTGGTGTTCCAGACCCAACACTGAACACAACTTATCTGCAAAGACTTCGCCAAATA
TGCCCACAAGGTGGAAATGCAAGTGTCATAGCCAATCTTGAATTGACAACACCTGATGCATTTGACAATAACTATTTCTCTAATCTTCTATCAAACCAAGGCCTCCTCCAGAGCGATCAG
GAACTATTTTCAACTACTGGGGCTGATACTGTCGCCATTGTCAACCACTTCAGTGCTAATCAGAGTGCTTTCTTTGAAAGCTTTGTGAAATCCATGATCAGAATGGGAAATCTTAGTGTT
TTAACAGGAACTCATGGGGAGATCAGGTTGAATTGCAGAGAAGTTAATGCGAATTCAGCTACAGCAGATAGTATTCTTGTGAGCTTAATA

Retrieve as FASTA