Entry information : SbPrx24 (Sobic.002G003200.1[2.1] / Sb02g000470[1.4])
Entry ID 912
Creation 2008-10-13 (Christophe Dunand)
Last sequence changes 2011-01-24 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx24 (Sobic.002G003200.1[2.1] / Sb02g000470[1.4])
Name (synonym) SbPrx24 (Sobic.002G003200.1[2.1] / Sb02g000470[1.4])
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx24
start..stop
S start..stop
SiPrx85 595 0 36..336 31..331
ZmPrx51 590 0 9..336 2..334
OsPrx97 538 0 32..336 38..342
TaPrx108 505 0 32..336 30..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 426294..426530 237 N° 2 426736..427509 774  
join(426294..426530,426736..427509)


exon

Literature and cross-references SbPrx24 (Sobic.002G003200.1[2.1] / Sb02g000470[1.4])
Literature Klein,R.R. et al., unpublished
DNA ref. Phytozome 12:   chromosome_2 (426303..427509)
EST ref. GenBank:   BI140714 [5' end]
Protein sequence: SbPrx24 (Sobic.002G003200.1[2.1] / Sb02g000470[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (305)
PWM (Da):   %s   36029.05 (33006.6) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.05 (6.98) Peptide Signal:   %s   cut: 32 range:32-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHSMSSSSMAPCTMIMASVAAVLVVLSSAAAAGLDMDFYSSTCPRVEAIVKEEMTEILKVSPTLAGPLLRLHFHDCFVRGCDGSVLLDSTPSSTSEKDATPNLTLRGFGSVQRVKDKLEQACPGTVSCADVLALMARDAVVLANGPSWPVALGRRDGRVSISNETNQLPPPTANFTRLVQMFAAKGLSVKDLVVLSGGHTLGTAHCNLFSDRLYNFTGANNLADVDPALDATYLARLRSRCRSLADNTTLNEMDPGSFLSFDASYYRLVAKRRGLFHSDAALLTDPATRAYVQRQATGLFAAEFFRDFADSMVKMSTIDVLTGAQGEIRNKCYLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 2, intron 1) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTCCATGTCGTCGTCGTCGATGGCGCCCTGCACCATGATCATGGCGAGCGTTGCAGCTGTGCTCGTCGTCCTTTCGTCGGCTGCCGCCGCAGGGCTGGACATGGATTTCTACAGC
AGCACGTGCCCGCGCGTGGAGGCCATCGTCAAGGAGGAGATGACGGAGATCCTCAAGGTGTCGCCGACGCTCGCCGGCCCGCTGCTCCGCCTCCATTTCCACGACTGCTTCGTCAGG
GTA
CATTGCTGTTGCGGTTGCTGCTGCATTATTGTTGCATTGCAAATTTGCATTGCACGTTACTTAATTTCCTACTACCTGCTATAGGACACCACACATGCATGCACGACGTACGCACGGCCA
CATGCATCTGCATATCGTCATGAACTAACAACTTTGCCGGCCATGGCCATGGCCATGGCCATGCATATATGCTGCCTGCCAGGGCTGCGACGGCTCCGTGCTACTGGACTCGACCCCTAG
CAGCACGTCGGAGAAGGACGCGACCCCGAACCTCACCCTGCGGGGCTTCGGCTCCGTGCAGCGCGTCAAGGACAAGCTAGAGCAGGCGTGCCCGGGCACCGTCTCGTGCGCCGATGTCCT
GGCGCTCATGGCGCGCGACGCCGTCGTGCTTGCCAACGGCCCGTCCTGGCCCGTCGCGCTGGGCCGCCGCGACGGCCGCGTCTCCATCTCCAACGAGACCAACCAGCTTCCCCCGCCCAC
CGCCAACTTCACCCGCCTCGTCCAGATGTTCGCCGCCAAGGGCCTCTCCGTCAAGGACCTCGTCGTGCTCTCCGGCGGCCACACCCTCGGCACCGCGCACTGCAACCTCTTCAGCGACCG
CCTCTACAACTTCACGGGCGCCAACAACCTCGCCGACGTCGACCCGGCGCTCGACGCCACCTACCTCGCCCGCCTCAGGTCCAGGTGCCGGAGCCTCGCCGACAACACCACGCTCAACGA
GATGGACCCCGGCAGCTTCCTCAGCTTCGACGCCAGCTACTACCGCCTCGTCGCAAAGCGCCGGGGACTCTTCCACTCCGACGCCGCGCTGCTCACCGACCCGGCCACCAGGGCCTACGT
CCAGCGCCAGGCCACGGGACTCTTCGCCGCCGAGTTCTTCCGCGACTTCGCCGACTCCATGGTCAAGATGTCCACCATCGACGTGCTCACCGGCGCGCAGGGAGAGATCAGAAACAAATG
CTACCTCGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATTCCATGTCGTCGTCGTCGATGGCGCCCTGCACCATGATCATGGCGAGCGTTGCAGCTGTGCTCGTCGTCCTTTCGTCGGCTGCCGCCGCAGGGCTGGACATGGATTTCTACAGC
AGCACGTGCCCGCGCGTGGAGGCCATCGTCAAGGAGGAGATGACGGAGATCCTCAAGGTGTCGCCGACGCTCGCCGGCCCGCTGCTCCGCCTCCATTTCCACGACTGCTTCGTCAGG
GGC
TGCGACGGCTCCGTGCTACTGGACTCGACCCCTAGCAGCACGTCGGAGAAGGACGCGACCCCGAACCTCACCCTGCGGGGCTTCGGCTCCGTGCAGCGCGTCAAGGACAAGCTAGAGCAG
GCGTGCCCGGGCACCGTCTCGTGCGCCGATGTCCTGGCGCTCATGGCGCGCGACGCCGTCGTGCTTGCCAACGGCCCGTCCTGGCCCGTCGCGCTGGGCCGCCGCGACGGCCGCGTCTCC
ATCTCCAACGAGACCAACCAGCTTCCCCCGCCCACCGCCAACTTCACCCGCCTCGTCCAGATGTTCGCCGCCAAGGGCCTCTCCGTCAAGGACCTCGTCGTGCTCTCCGGCGGCCACACC
CTCGGCACCGCGCACTGCAACCTCTTCAGCGACCGCCTCTACAACTTCACGGGCGCCAACAACCTCGCCGACGTCGACCCGGCGCTCGACGCCACCTACCTCGCCCGCCTCAGGTCCAGG
TGCCGGAGCCTCGCCGACAACACCACGCTCAACGAGATGGACCCCGGCAGCTTCCTCAGCTTCGACGCCAGCTACTACCGCCTCGTCGCAAAGCGCCGGGGACTCTTCCACTCCGACGCC
GCGCTGCTCACCGACCCGGCCACCAGGGCCTACGTCCAGCGCCAGGCCACGGGACTCTTCGCCGCCGAGTTCTTCCGCGACTTCGCCGACTCCATGGTCAAGATGTCCACCATCGACGTG
CTCACCGGCGCGCAGGGAGAGATCAGAAACAAATGCTACCTCGTCAACTGA

Retrieve as FASTA