Entry information : MePrx63 (cassava4.1_022224m)
Entry ID 9121
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: MePrx63 (cassava4.1_022224m)
Name (synonym) MePrx63 (cassava4.1_022224m)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx63
start..stop
S start..stop
MePrx22 575 0 1..327 1..328
RcPrx30 568 0 1..327 1..329
PtPrx59 554 0 1..327 1..330
PtPrx35 551 0 1..327 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1008231..1008425 195 N° 2 1008547..1008738 192 N° 3 1008859..1009452 594  
join(1008231..1008425,1008547..1008738,1008859..1009452)


exon

Literature and cross-references MePrx63 (cassava4.1_022224m)
DNA ref. Phytozome 12:   scaffold08265 (1008231..1009452)
Protein sequence: MePrx63 (cassava4.1_022224m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (310)
PWM (Da):   %s   35985.08 (34253.1)  
PI (pH):   %s   5.24 (5.24) Peptide Signal:   %s   cut: 18 range:18-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLFTAFLLLVAVASAAPLRPRFYSETCPEAEVIVRNVMKKTMIREPRSVASVMRFQFHDCFVNGCDASMLLDDTATMPGEKQALSNVNSLRSYEVVDEIKQELEEVCPETVSCADIIIMASRDAVALSGGPDWEVKLGRRDSLTASQEDSNNIMPSPRANASLLIDLFARFNLSIKDLVALSGSHSIGKARCFSIVFRLYNQSGTGKPDPTIEPSYRQKLNTLCPLGGDGNVTGDLDATTTVFDNVYFQDLVAGRGFLNSDQTLFTFPETRQYVRLFSKDQKAFFKAFVEGMIKMGDLQSGRPGEIRTNCRVANGQRPVDVLLES

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTGTATGTA CGATCTTTAC GTCCCATGGT TATAGCAAAA CAGGACCATA AAAAAGTTTT AAATATTTTC TTAAAATAAA ATATCGAAAT CCTTAATTTT CGTATTAAAA TATGCACAAT  CATTAAATTA GGGATACTTT TCCATATTCT AATATATAAA TGTTGGTCTA TCTATACCCA AATTGTTATA TAGCTTTAAT AGAAAAATAT AATCTTTGCT TATAATTTTC GCAATTTTCA  TTCAAATATT TTAATTTAAA CAGCTTCTCA CGATTTCAAC ACGTAATTGC AATTTTATTT AGTCACTCAA AATTAAAATT GAAAATAATA TCTTTTACTG AAGTTAATGA TAGCGCTATT  CATAGATGTG GGGCATGAAT CATGTTTCTT CAGCTTGGCC GCGAGGATGA GGCAAAAATT ATACAATCTC GTAGGCCGAC TGCTAGCCCA ATTAATATTT TCTGAACCCA CTTTTCCAAG  GCCGTGTCTA AAATGCCCAT GCCTCGGCAT TTCTTTCTTC CTTCTTCGTC TTTTTTTTTT TCCAATCAAA TCATCGGACA GGATTATTAT TTTTTATTTA TTTTAATTTA ATTTTTAATT  TTTAATTTTT AATTATTTCA ATTCAATTTG ATTTTGATAA AAAAAATCAA ACTGAACCAA TTAGTAATAA TAGTATATTA TTTTGAATGA TATAAAGAGA TTAGACCATA ATTAAAATAG  AATATTTTAA TTAAATTTTA AAATATTAAA AATCAAGTGT AAAAAATGAA AAAATTTATT AAAAAATTCA ATCAATTAAA TCGAATTTAA AATAAATTAG ATTGGTTCAA TTCAATTTCT  ATCTAAAATT AATTTGATTC GATTTTTATA AATATTAAAA TTTTAATTTA TTCGATTCAG TTTGATTTTA AATCTAACCG ATTAAATAAT GATCCCAATT TATTCTAGAT TAATGACTGT  TGAAAGCAAA GTGCTTTTTT TTTTTTGTAA TTTTAAATAT ATTTGATACT AAAATTCGAA TTCAAGACCA CATGCTATGG AGTAATTATT TCTCACATAA TGGTCATAAT ATTCAAATTT  TCTTCACTTC TTATATGGAA GGACAAAGAA TTTGAAAATG AAGATAATGT TTAGAGCGAT TTTACTTATA AAAAGTAATA TTTTTTTATT TTATTTTTTA CAAAAATTTA CAACTTTTGT  TTTGTAAAAA AAAATATTGA AAACAACGAA CAAAAATAAT ATTCTAATTT TAAAAATTAT TTGTATAATT AATTCATAAT TAAAGGTATC AAGCGTTAAA GCACAGGAAA TGCATGAATT  TGGTTCAAGT CTTTGTACTT GATAATGTCA GAGACATTGG ACACACAAAT CCCATAGCAT ACAAAAGGTT TATGTCCCTT CATTATATGC ACTTAATTGC TCAGCAAATA GAATGGAAAC  TGGCAAACCA GGACACCAAA CTCAAACACT CAACTCATAT TTGCTTTTAT CCTCATGCTT GATGGCCTGT ACAGCAACTG CAACATTCTG CCTGTTGCCC ATTTACTCCA TGGTTTTATA  AATTGCTTCA CAGCTGGTTT TAATCCCCAA ATGCTGATTC CTTCATTCCC CCCTTTATAA TCTTGTCCGG CGCAAATTCA GATTAGTTTG AAGCAGTAAG CTTCCGATAC TGGCCGATAT  ATACCAAAAA AAGAAAAAGA TATGGTTGTG CTGTAACACT ATTCCTGTTG ATATTTCTTT CAAAGCCATG ATCCAATTGT CCAAGATCTT GCCTCCTTTT GTCAAAAAAC AATCCTGTAA  TCTGTTAGCA CCCAGAAAAA ATAAATTAAA TAAAAAAGAA AAAGCATTTA AATCCCTTTC CTGTGCCCAT CATCCCATGA CTTGGCATCC ATTACATACA CAAAAATCCA TTCATCCGTC 
AATTCAAGAA GTTTAAAAGC CCATACAAAG AACCAAAATA GACCACATCA CATAACAGCA TCACCTCTGG TGTCCAAAAC 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTCTTTACAGCCTTTCTTCTACTCGTTGCCGTGGCCTCTGCAGCGCCACTCCGGCCACGATTCTACTCTGAAACATGTCCGGAAGCTGAAGTAATTGTGAGGAATGTGATG
AAGAAGACTATGATTAGAGAACCAAGAAGCGTTGCCTCTGTCATGCGCTTTCAGTTCCATGATTGCTTTGTTAAT
GTAAAAAACTATACTGCATAGCCAAAAAGCTTTTTTCCCTTTCAG
TTTTTATATCTACTTAGATCTTTAATTAATTTTTCTTGATTTGGGTTTTGAATGGTTTTGCATTTTCTTGTAAAAGGGCTGTGATGCTTCTATGTTGCTGGATGATACAGCAACCATGCC
AGGAGAGAAGCAAGCTCTTTCCAATGTAAATTCTCTAAGGTCTTATGAAGTTGTCGATGAAATCAAGCAAGAGCTAGAGGAGGTCTGTCCAGAAACTGTTTCTTGTGCAGATATAATTAT
CATGGCTTCTAGAGATGCTGTTGCCCTG
GTAATTTTTTCTTTCTAATTTTGATCTTTGCTTGCTTTAGCTTTTACACCAAAATAGCTTGATGAAGCCCGCATTTTAACAGTAGTTGGTTT
TGATTATTTTTGTTCTCTTGGTTACCAGAGTGGAGGACCTGATTGGGAGGTGAAGTTAGGGAGACGAGATAGCTTGACAGCAAGCCAAGAAGACTCAAACAATATCATGCCAAGTCCAAG
AGCCAATGCAAGCCTTCTCATAGACCTCTTTGCAAGATTCAATCTCTCTATCAAAGATCTTGTAGCCCTTTCAGGGTCACATTCCATTGGCAAAGCTAGGTGTTTTTCTATAGTGTTTAG
GCTTTATAATCAATCTGGAACAGGCAAGCCAGATCCAACCATTGAGCCAAGCTACAGACAAAAACTAAACACACTGTGTCCACTTGGTGGAGATGGAAATGTGACAGGAGACCTTGATGC
AACAACAACTGTGTTTGATAATGTGTATTTCCAGGATTTGGTTGCAGGAAGAGGGTTTCTTAATTCTGATCAAACACTTTTCACATTTCCTGAAACAAGACAATATGTGAGACTGTTTTC
CAAGGACCAAAAAGCTTTTTTCAAGGCTTTTGTTGAGGGAATGATAAAGATGGGGGACTTGCAGTCTGGGAGGCCTGGAGAGATCAGAACCAACTGCAGAGTGGCCAACGGCCAACGGCC
TGTTGATGTGCTGCTGGAGTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCCTCTCTTTACAGCCTTTCTTCTACTCGTTGCCGTGGCCTCTGCAGCGCCACTCCGGCCACGATTCTACTCTGAAACATGTCCGGAAGCTGAAGTAATTGTGAGGAATGTGATG
AAGAAGACTATGATTAGAGAACCAAGAAGCGTTGCCTCTGTCATGCGCTTTCAGTTCCATGATTGCTTTGTTAAT
GGCTGTGATGCTTCTATGTTGCTGGATGATACAGCAACCATGCCA
GGAGAGAAGCAAGCTCTTTCCAATGTAAATTCTCTAAGGTCTTATGAAGTTGTCGATGAAATCAAGCAAGAGCTAGAGGAGGTCTGTCCAGAAACTGTTTCTTGTGCAGATATAATTATC
ATGGCTTCTAGAGATGCTGTTGCCCTG
AGTGGAGGACCTGATTGGGAGGTGAAGTTAGGGAGACGAGATAGCTTGACAGCAAGCCAAGAAGACTCAAACAATATCATGCCAAGTCCAAGA
GCCAATGCAAGCCTTCTCATAGACCTCTTTGCAAGATTCAATCTCTCTATCAAAGATCTTGTAGCCCTTTCAGGGTCACATTCCATTGGCAAAGCTAGGTGTTTTTCTATAGTGTTTAGG
CTTTATAATCAATCTGGAACAGGCAAGCCAGATCCAACCATTGAGCCAAGCTACAGACAAAAACTAAACACACTGTGTCCACTTGGTGGAGATGGAAATGTGACAGGAGACCTTGATGCA
ACAACAACTGTGTTTGATAATGTGTATTTCCAGGATTTGGTTGCAGGAAGAGGGTTTCTTAATTCTGATCAAACACTTTTCACATTTCCTGAAACAAGACAATATGTGAGACTGTTTTCC
AAGGACCAAAAAGCTTTTTTCAAGGCTTTTGTTGAGGGAATGATAAAGATGGGGGACTTGCAGTCTGGGAGGCCTGGAGAGATCAGAACCAACTGCAGAGTGGCCAACGGCCAACGGCCT
GTTGATGTGCTGCTGGAGTCT

Retrieve as FASTA