Entry information : MePrx70 ( cassava4.1_023402m)
Entry ID 9127
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-24 (Christophe Dunand)
Peroxidase information: MePrx70 ( cassava4.1_023402m)
Name (synonym) MePrx70 ( cassava4.1_023402m)
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx70
start..stop
S start..stop
MePrx16 641 0 1..340 11..350
MePrx115 564 0 2..340 8..343
HbPrx01 520 0 1..340 7..346
MePrx57 468 6e-167 1..338 14..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 944..1147 204 N° 2 1269..1460 192 N° 3 1638..1806 169 N° 4 2202..2656 455
join(944..1147,1269..1460,1638..1806,2202..2656)


exon

Literature and cross-references MePrx70 ( cassava4.1_023402m)
DNA ref. Phytozome 12:   scaffold07430 (944..2656)
Protein sequence: MePrx70 ( cassava4.1_023402m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (321)
PWM (Da):   %s   36535.66 (34667.6)  
PI (pH):   %s   7.38 (7.74) Peptide Signal:   %s   cut: 20 range:20-340
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLVLIALCAILIESSGGLAQAKLSPTFYDQSCPFVSHIIREVIADALQTDKRIGASLIRLHFHDCFVQGCDASVLLDNSDTILSEKEALPNNNSLRGFDVVDKMKAWLEFACPGVVSCADILTIAAQESVALSGGPIWRNQLGRRDSRTANRSLANTNLPGPFLPLQGLKSAFTAIGLNNHTDLVALSGAHTFGRAQCGGFIHRLYNFNNTGRPDPTLNPTYLRILRKICPQGGNTTVLANFDPTTPDTFDNDYYSNLLVGKGLLQTDQELFSTPGADTAKIVKKFSANQTAFFESFVVSMLRMGNLKVLTGTAGEIRLNCRKVNGDSSGGADTLLVSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGTGCTGATAGCTTTATGCGCAATTCTGATTGAATCATCTGGAGGCTTGGCCCAGGCTAAGCTATCTCCAACATTTTATGATCAAAGCTGCCCATTTGTCTCCCACATTATTCGT
GAAGTCATCGCAGACGCATTGCAAACTGATAAAAGGATTGGTGCCAGCCTCATCAGGCTTCACTTCCATGACTGCTTTGTGCAA
GTAAACTTCAATAACCATCANNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNCTGTGATCAGATGAGGCCTTGATTTAATGAGGAGTTGAAATGTTTATATTGATATTGTTACAGGGTTGTGATGCATCAGTTTTGTTGGACAACAGTGA
TACTATATTGAGTGAGAAGGAAGCTCTTCCTAATAATAACTCACTCAGAGGTTTTGACGTTGTTGATAAAATGAAGGCTTGGTTGGAGTTTGCTTGTCCTGGAGTTGTTTCTTGCGCTGA
TATTCTCACTATTGCTGCTCAAGAATCTGTTGCTTTG
GTAACGTTGGCTTTCAATATGTTTATTTCAATTTTTTAATGAGAAATTGAATTTTATCACACTAACATATTTTAGATTTCAGC
AACGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTAATGATCTATGTATGAAATAATGATGGAGTTGATGGCTAGCTATATGCAGTCTGGAGGGCCAATATGGAGAAATCA
ACTTGGAAGGAGAGATAGCAGAACAGCAAACAGAAGTCTAGCTAATACTAACCTTCCAGGTCCCTTCTTGCCCCTCCAGGGTCTCAAGTCCGCCTTCACCGCCATCGGCCTCAACAACCA
CACCGATCTAGTTGCCCTATCTG
GTAATTTTCAATTATTCTTTTTCATGTAATACTCTCTAATAACTCATTGCAATAAGACTGGATGACTTTTTTAATTTTCATTTAAAATATTGTTGAT
CGTAGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTAAGAAATATAGCATCGATTTTCNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGGCATTGATCAGGTGCTCATACATTTGGAAGAGCTCAATGTGGAGGATTTATCCACCGTTTATACAACTTCAAT
AACACCGGTCGCCCGGATCCAACATTGAACCCAACCTATTTGCGAATTCTCCGAAAAATATGTCCTCAAGGAGGAAATACAACTGTATTAGCTAATTTCGATCCCACAACTCCAGATACT
TTTGACAATGATTATTATTCAAATCTTCTAGTTGGGAAAGGCCTTCTTCAGACAGACCAGGAACTATTTTCAACTCCCGGAGCTGATACTGCTAAAATTGTTAAAAAATTTAGTGCTAAT
CAGACTGCTTTCTTTGAAAGCTTTGTGGTGTCCATGCTCAGAATGGGAAATCTCAAAGTTTTAACAGGAACTGCTGGAGAGATCAGGTTGAATTGTAGGAAAGTTAATGGAGATTCATCA
GGCGGAGCAGACACTCTTCTCGTTAGCTCCATG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGGTGCTGATAGCTTTATGCGCAATTCTGATTGAATCATCTGGAGGCTTGGCCCAGGCTAAGCTATCTCCAACATTTTATGATCAAAGCTGCCCATTTGTCTCCCACATTATTCGT
GAAGTCATCGCAGACGCATTGCAAACTGATAAAAGGATTGGTGCCAGCCTCATCAGGCTTCACTTCCATGACTGCTTTGTGCAA
GGTTGTGATGCATCAGTTTTGTTGGACAACAGTGAT
ACTATATTGAGTGAGAAGGAAGCTCTTCCTAATAATAACTCACTCAGAGGTTTTGACGTTGTTGATAAAATGAAGGCTTGGTTGGAGTTTGCTTGTCCTGGAGTTGTTTCTTGCGCTGAT
ATTCTCACTATTGCTGCTCAAGAATCTGTTGCTTTG
TCTGGAGGGCCAATATGGAGAAATCAACTTGGAAGGAGAGATAGCAGAACAGCAAACAGAAGTCTAGCTAATACTAACCTTCCA
GGTCCCTTCTTGCCCCTCCAGGGTCTCAAGTCCGCCTTCACCGCCATCGGCCTCAACAACCACACCGATCTAGTTGCCCTATCTG
GTGCTCATACATTTGGAAGAGCTCAATGTGGAGGA
TTTATCCACCGTTTATACAACTTCAATAACACCGGTCGCCCGGATCCAACATTGAACCCAACCTATTTGCGAATTCTCCGAAAAATATGTCCTCAAGGAGGAAATACAACTGTATTAGCT
AATTTCGATCCCACAACTCCAGATACTTTTGACAATGATTATTATTCAAATCTTCTAGTTGGGAAAGGCCTTCTTCAGACAGACCAGGAACTATTTTCAACTCCCGGAGCTGATACTGCT
AAAATTGTTAAAAAATTTAGTGCTAATCAGACTGCTTTCTTTGAAAGCTTTGTGGTGTCCATGCTCAGAATGGGAAATCTCAAAGTTTTAACAGGAACTGCTGGAGAGATCAGGTTGAAT
TGTAGGAAAGTTAATGGAGATTCATCAGGCGGAGCAGACACTCTTCTCGTTAGCTCCATG

Retrieve as FASTA