Entry information : MePrx74 (cassava4.1_024068m)
Entry ID 9131
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx74 (cassava4.1_024068m)
Name (synonym) MePrx74 (cassava4.1_024068m)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx74
start..stop
S start..stop
RcPrx01 473 2e-169 1..329 1..326
GaPrx08 426 6e-151 9..329 10..327
GhPrx35 425 1e-150 9..329 10..327
CclPrx24 417 2e-147 7..329 8..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 76147..76365 219 N° 2 75881..76063 183 N° 3 75641..75806 166 N° 4 75157..75575 419
complement(join(75157..75575,75641..75806,75881..76063,76147..76365))


exon

Literature and cross-references MePrx74 (cassava4.1_024068m)
DNA ref. Phytozome 12:   scaffold00784 (76365..75157)
Protein sequence: MePrx74 (cassava4.1_024068m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35709.09  
PI (pH):   %s   6.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MINCNLKPLFLAIIVILTYVVVTSKGQLRVGFYSQTCPSAESIVRNAVQEAVFGDRQMAPRLLRLLFHDCFVQGCDGSILLENTETSERRAEGNLGLAGFEVIQSAKTQLEATCPGVVSCADIVALAARDAVAMTAGPFFGIPTGRRDGRISNIQFAANLPDVDDSIELLRSKFKEKGLSDRELVLLSGGGHSIGTTACFFMPKRLYNFTGHGDSDPAIDSQFLPDLKAQCPFNGDVDVRLPLDSSSEFIFDGHIFHNIRNGFAVLASDARLYDDMHTRQIVNFYSGFPSVIRRLSFKADFAAAMVKMGSIGVKTGSDGEIRRVCNSV

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAATTGCAATCTAAAACCTCTGTTTTTGGCGATAATTGTAATTCTTACTTACGTTGTTGTGACATCAAAAGGGCAATTACGAGTTGGATTCTACTCCCAGACATGCCCATCTGCA
GAATCCATTGTCCGCAATGCTGTTCAAGAAGCGGTTTTTGGTGATCGCCAAATGGCTCCAAGGTTGCTTAGGCTTTTGTTCCATGACTGCTTCGTTCAG
GTTCCTGATCATCCCATACTA
CTACTTAAAAAGATATCTGTCCATATTTTGATGGACTTCTTTTTTTTCCCATTTTGTTGTAGGGCTGCGATGGGTCAATTTTGCTAGAAAATACCGAAACTAGTGAGAGAAGAGCAGAAG
GGAACTTGGGTCTTGCAGGTTTTGAAGTGATACAAAGTGCCAAGACGCAACTGGAAGCCACTTGCCCTGGAGTAGTTTCTTGTGCAGACATTGTGGCTTTAGCTGCCCGTGATGCTGTTG
CCATG
GTACTTGATTCAAACAGAGAAATATATCTTACTAAACACTCTAATAATTCACCCAATGATGCTCTGCTTTGCAGACTGCTGGGCCATTTTTTGGCATTCCAACAGGGCGAAGAGA
TGGTCGAATTTCAAATATTCAATTTGCTGCCAATTTGCCAGACGTTGATGACTCAATTGAGCTTCTCAGGTCCAAGTTCAAAGAGAAAGGCCTTTCAGACAGAGAACTCGTCCTTCTCAG
TGGTG
GTATATATATTTACAAGATTGTAGGCTAAATATGAAATTATCTTGAACTGAAACAAATATTTCAGGTGGGCATTCAATTGGAACCACTGCATGTTTCTTCATGCCAAAGAGACTC
TACAACTTCACTGGTCATGGCGACTCTGATCCTGCAATCGATTCACAATTTCTACCAGACCTTAAAGCTCAGTGCCCTTTCAATGGAGATGTCGATGTTCGACTACCTCTTGACAGCTCC
TCTGAATTTATATTTGACGGCCATATCTTCCACAATATCAGAAATGGGTTTGCGGTTCTAGCATCTGATGCTAGGCTTTATGATGACATGCACACCAGACAGATAGTTAATTTCTATAGT
GGCTTCCCGAGTGTCATTAGACGACTGTCGTTTAAAGCTGATTTTGCTGCAGCAATGGTGAAGATGGGGAGTATTGGTGTTAAAACAGGATCGGATGGTGAGATTAGACGAGTTTGCAAC
TCTGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCAATTGCAATCTAAAACCTCTGTTTTTGGCGATAATTGTAATTCTTACTTACGTTGTTGTGACATCAAAAGGGCAATTACGAGTTGGATTCTACTCCCAGACATGCCCATCTGCA
GAATCCATTGTCCGCAATGCTGTTCAAGAAGCGGTTTTTGGTGATCGCCAAATGGCTCCAAGGTTGCTTAGGCTTTTGTTCCATGACTGCTTCGTTCAG
GGCTGCGATGGGTCAATTTTG
CTAGAAAATACCGAAACTAGTGAGAGAAGAGCAGAAGGGAACTTGGGTCTTGCAGGTTTTGAAGTGATACAAAGTGCCAAGACGCAACTGGAAGCCACTTGCCCTGGAGTAGTTTCTTGT
GCAGACATTGTGGCTTTAGCTGCCCGTGATGCTGTTGCCATG
ACTGCTGGGCCATTTTTTGGCATTCCAACAGGGCGAAGAGATGGTCGAATTTCAAATATTCAATTTGCTGCCAATTTG
CCAGACGTTGATGACTCAATTGAGCTTCTCAGGTCCAAGTTCAAAGAGAAAGGCCTTTCAGACAGAGAACTCGTCCTTCTCAGTGGTG
GTGGGCATTCAATTGGAACCACTGCATGTTTC
TTCATGCCAAAGAGACTCTACAACTTCACTGGTCATGGCGACTCTGATCCTGCAATCGATTCACAATTTCTACCAGACCTTAAAGCTCAGTGCCCTTTCAATGGAGATGTCGATGTTCGA
CTACCTCTTGACAGCTCCTCTGAATTTATATTTGACGGCCATATCTTCCACAATATCAGAAATGGGTTTGCGGTTCTAGCATCTGATGCTAGGCTTTATGATGACATGCACACCAGACAG
ATAGTTAATTTCTATAGTGGCTTCCCGAGTGTCATTAGACGACTGTCGTTTAAAGCTGATTTTGCTGCAGCAATGGTGAAGATGGGGAGTATTGGTGTTAAAACAGGATCGGATGGTGAG
ATTAGACGAGTTTGCAACTCTGTTAAT

Retrieve as FASTA