Entry information : MePrx81 (cassava4.1_025167m)
Entry ID 9136
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx81 (cassava4.1_025167m)
Name (synonym) MePrx81 (cassava4.1_025167m)
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx81
start..stop
S start..stop
RcPrx56 529 0 1..320 1..320
PtPrx74 517 0 1..320 1..320
VvPrx13 494 2e-178 1..320 1..318
PtPrx112 494 3e-178 1..320 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 107899..108117 219 N° 2 107602..107796 195 N° 3 106956..107504 549  
complement(join(106956..107504,107602..107796,107899..108117))


exon

Literature and cross-references MePrx81 (cassava4.1_025167m)
DNA ref. Phytozome 12:   scaffold11267 (108117..106956)
Protein sequence: MePrx81 (cassava4.1_025167m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (303)
PWM (Da):   %s   34867.78 (32952.7) Transmb domain:   %s   i5-24o
PI (pH):   %s   8.89 (8.90) Peptide Signal:   %s   cut: 19 range:19-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASHVIFYLSALLILTAAATTMGSSSSLSPYYYDRVCPEALPAIKRLIEAAVYREPRMGASLLRLHFHDCFVNGCDASVLLDPSPTIDSEKNALANINSARGFEVIDEIKQEVDKVCGRPVVSCADILAVAARDSVVALGGPTWKVLLGRRDSTTASRAKANADIPSPFMDLPALIKNFKNQGLDERDLVALSGGHTIGFAQCFVFRDRIYNETNIDPKFAKARRSTCPRTGSDSNLSPLDPTPAHFDTAYFTNLKMKKGLLHSDQQLFNGGTTDAIVKTYSSNAKAFSADFARSMVKMGNIKPITGKQGEIRFNCRKVNY

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGCATGTCATCTTCTATCTTTCTGCCTTGCTCATTTTGACTGCTGCTGCTACTACTATGGGTTCTTCGTCTTCACTTTCTCCTTATTACTATGACAGAGTGTGTCCCGAAGCT
TTACCAGCTATTAAACGACTCATTGAGGCTGCAGTGTACAGAGAGCCACGGATGGGTGCTTCTTTACTACGTCTGCACTTCCATGACTGTTTTGTTAAC
GTACAACATTTTCCTATTTGA
TCATTTCAATTACAGTTGATATTCAAGTTATAATATAGTAATTAGTACGTATTAACGATTTGACTTTGTTTGGCAATACAGGGCTGTGATGCGTCAGTTCTTCTGGATCCTTCACCCACT
ATTGACAGCGAAAAGAACGCTCTCGCTAATATAAACTCTGCTAGAGGATTTGAAGTTATCGACGAGATTAAGCAAGAAGTGGATAAAGTATGCGGTCGCCCAGTGGTCTCCTGCGCAGAT
ATTTTGGCTGTCGCAGCTAGAGATTCTGTAGTTGCG
GTAATTGCTAATTTTATATCTATAGATAGCTTATTGCAGTAAACATATGGAAATTAGTGATGGNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNGCAGCTAGGAGGGCCAACATGGAAAGTCCTACTTGGTAGAAGAGATTCAACTACGGCGAGCAGGGCAAAGGCAAACGCTGACATCCCATCCCCATTCATGGACCTTCCTGC
ACTTATTAAGAACTTCAAAAACCAAGGTCTCGATGAAAGAGACCTTGTTGCTCTCTCTGGTGGCCACACTATAGGGTTTGCACAATGTTTTGTTTTCAGGGACCGAATCTACAACGAAAC
TAATATTGACCCTAAATTTGCAAAAGCTCGAAGATCAACCTGTCCGCGCACTGGTAGCGATTCAAACCTTTCGCCTCTAGACCCAACACCAGCACACTTCGATACCGCATACTTCACCAA
TTTGAAAATGAAAAAAGGGCTTCTTCATTCGGATCAACAACTGTTTAATGGTGGCACTACTGATGCTATAGTAAAGACTTACAGCTCAAACGCAAAAGCTTTTTCGGCGGATTTTGCCAG
GTCTATGGTGAAGATGGGGAATATAAAACCAATAACGGGAAAGCAAGGCGAAATCCGTTTCAACTGCAGGAAAGTGAATTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGCATGTCATCTTCTATCTTTCTGCCTTGCTCATTTTGACTGCTGCTGCTACTACTATGGGTTCTTCGTCTTCACTTTCTCCTTATTACTATGACAGAGTGTGTCCCGAAGCT
TTACCAGCTATTAAACGACTCATTGAGGCTGCAGTGTACAGAGAGCCACGGATGGGTGCTTCTTTACTACGTCTGCACTTCCATGACTGTTTTGTTAAC
GGCTGTGATGCGTCAGTTCTT
CTGGATCCTTCACCCACTATTGACAGCGAAAAGAACGCTCTCGCTAATATAAACTCTGCTAGAGGATTTGAAGTTATCGACGAGATTAAGCAAGAAGTGGATAAAGTATGCGGTCGCCCA
GTGGTCTCCTGCGCAGATATTTTGGCTGTCGCAGCTAGAGATTCTGTAGTTGCG
CTAGGAGGGCCAACATGGAAAGTCCTACTTGGTAGAAGAGATTCAACTACGGCGAGCAGGGCAAAG
GCAAACGCTGACATCCCATCCCCATTCATGGACCTTCCTGCACTTATTAAGAACTTCAAAAACCAAGGTCTCGATGAAAGAGACCTTGTTGCTCTCTCTGGTGGCCACACTATAGGGTTT
GCACAATGTTTTGTTTTCAGGGACCGAATCTACAACGAAACTAATATTGACCCTAAATTTGCAAAAGCTCGAAGATCAACCTGTCCGCGCACTGGTAGCGATTCAAACCTTTCGCCTCTA
GACCCAACACCAGCACACTTCGATACCGCATACTTCACCAATTTGAAAATGAAAAAAGGGCTTCTTCATTCGGATCAACAACTGTTTAATGGTGGCACTACTGATGCTATAGTAAAGACT
TACAGCTCAAACGCAAAAGCTTTTTCGGCGGATTTTGCCAGGTCTATGGTGAAGATGGGGAATATAAAACCAATAACGGGAAAGCAAGGCGAAATCCGTTTCAACTGCAGGAAAGTGAAT
TAT

Retrieve as FASTA