Entry information : MePrx85 (cassava4.1_025536m)
Entry ID 9140
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx85 (cassava4.1_025536m)
Name (synonym) MePrx85 (cassava4.1_025536m)
Class Class III peroxidase    [Orthogroup: Prx169]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx85
start..stop
S start..stop
MePrx09 462 1e-164 10..349 7..351
MePrx87 449 1e-159 1..349 1..349
RcPrx11 442 2e-156 19..349 20..354
RcPrx47 431 2e-152 1..349 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 876272..876518 247 N° 2 876609..876790 182 N° 3 876895..877512 618  
join(876272..876518,876609..876790,876895..877512)


exon

Literature and cross-references MePrx85 (cassava4.1_025536m)
DNA ref. Phytozome 12:   scaffold06814 (876272..877512)
Protein sequence: MePrx85 (cassava4.1_025536m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349 (330)
PWM (Da):   %s   38253.27 (36265.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.76 (5.76) Peptide Signal:   %s   cut: 28 range:20-349
Sequence 390
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATATYFACLLLISSTLMGFSFSVIQAQSRPPIVNGLSWTFYQTTCPQLEAIIRSELQQVFATNIGQAAGLLRLQFHDCFVQGCDGSILLERGSERTEIPNRTLRPEAFQILENLRQIVHAQCGLVVSCSDILTIAARDSVVLSGGPDYEVPLGRRDGVTFAPVNQTLIDLIPATANVSTIISQFSRKNLNVTDVVALSGAHTIGISSCSSFTNRLYPTIDPTMDPAFAASLMQICPSLDSTNVAVLDVRSPNTFDNQYYANLFSRQGLLNSDQNIRRDARTLGYVTRFFTNQTFFFRMFVDSMVKMGQVDVLTGTQGEIRANCFRRNSDNLDLLSVAKENLGSSSTMR

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTACTGCCACTTACTTCGCTTGTCTCCTTCTGATCTCTTCTACCTTAATGGGTTTTTCTTTTAGTGTCATCCAGGCACAAAGCAGACCTCCCATAGTCAATGGTCTCTCCTGGACAT
TCTACCAAACTACTTGTCCTCAACTTGAAGCCATTATCAGAAGTGAGCTCCAGCAAGTTTTCGCCACAAACATTGGCCAAGCTGCTGGGTTGCTTCGTCTTCAGTTCCATGACTGCTTTG
TCCAAG
GTCCCTCCATATATATAGTACATATCAGGTTCTTGTGTATGTGGTCATTTCTGAGAATGTGAGATCAGCTTATACTTGATAATTTTACAGGATGCGATGGATCGATACTGCTTG
AAAGAGGAAGCGAGAGGACCGAAATTCCTAATCGGACCTTGAGACCAGAAGCATTTCAGATCCTCGAGAATCTCCGGCAGATTGTTCACGCACAGTGTGGCCTTGTCGTCTCTTGCTCTG
ATATTCTCACGATCGCTGCTCGTGATTCCGTCGTCCTG
GTAACTACAATAAGATTCAGATTTTAGAAACTAATTTTCTTTTTCCTTCGTGGGTGGTTTGGATTTATAACCTCATTTGTCC
TTCTTCTTTACTTGAATTGCAGAGTGGTGGCCCAGACTACGAGGTTCCATTGGGAAGGCGAGATGGAGTAACATTCGCACCAGTAAATCAAACACTTATAGATTTAATTCCAGCAACTGC
CAACGTTAGCACAATCATTAGCCAGTTTTCAAGAAAAAACCTGAATGTTACAGATGTTGTAGCCCTGTCAGGAGCTCACACCATAGGCATCAGCAGTTGCAGCTCATTCACTAATCGCCT
ATATCCAACCATAGATCCTACAATGGACCCAGCTTTTGCTGCGTCTCTCATGCAGATCTGTCCTTCATTGGACTCCACTAACGTTGCTGTTCTAGATGTTCGATCTCCTAACACTTTTGA
CAATCAGTACTATGCTAATTTGTTCAGCCGTCAGGGCCTGCTAAACTCGGACCAGAACATAAGACGAGATGCCAGAACATTGGGCTATGTTACTAGGTTTTTTACTAATCAAACATTCTT
CTTTCGTATGTTCGTGGATTCCATGGTGAAAATGGGGCAAGTGGATGTGTTAACAGGGACACAAGGGGAGATTCGTGCCAATTGCTTCAGGAGAAATTCTGATAACCTGGATTTGTTGTC
TGTGGCGAAAGAGAATCTGGGTTCATCTTCTACAATGAGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTACTGCCACTTACTTCGCTTGTCTCCTTCTGATCTCTTCTACCTTAATGGGTTTTTCTTTTAGTGTCATCCAGGCACAAAGCAGACCTCCCATAGTCAATGGTCTCTCCTGGACAT
TCTACCAAACTACTTGTCCTCAACTTGAAGCCATTATCAGAAGTGAGCTCCAGCAAGTTTTCGCCACAAACATTGGCCAAGCTGCTGGGTTGCTTCGTCTTCAGTTCCATGACTGCTTTG
TCCAAG
GATGCGATGGATCGATACTGCTTGAAAGAGGAAGCGAGAGGACCGAAATTCCTAATCGGACCTTGAGACCAGAAGCATTTCAGATCCTCGAGAATCTCCGGCAGATTGTTCACG
CACAGTGTGGCCTTGTCGTCTCTTGCTCTGATATTCTCACGATCGCTGCTCGTGATTCCGTCGTCCTG
AGTGGTGGCCCAGACTACGAGGTTCCATTGGGAAGGCGAGATGGAGTAACAT
TCGCACCAGTAAATCAAACACTTATAGATTTAATTCCAGCAACTGCCAACGTTAGCACAATCATTAGCCAGTTTTCAAGAAAAAACCTGAATGTTACAGATGTTGTAGCCCTGTCAGGAG
CTCACACCATAGGCATCAGCAGTTGCAGCTCATTCACTAATCGCCTATATCCAACCATAGATCCTACAATGGACCCAGCTTTTGCTGCGTCTCTCATGCAGATCTGTCCTTCATTGGACT
CCACTAACGTTGCTGTTCTAGATGTTCGATCTCCTAACACTTTTGACAATCAGTACTATGCTAATTTGTTCAGCCGTCAGGGCCTGCTAAACTCGGACCAGAACATAAGACGAGATGCCA
GAACATTGGGCTATGTTACTAGGTTTTTTACTAATCAAACATTCTTCTTTCGTATGTTCGTGGATTCCATGGTGAAAATGGGGCAAGTGGATGTGTTAACAGGGACACAAGGGGAGATTC
GTGCCAATTGCTTCAGGAGAAATTCTGATAACCTGGATTTGTTGTCTGTGGCGAAAGAGAATCTGGGTTCATCTTCTACAATGAGA

Retrieve as FASTA