Entry information : MePrx92 (cassava4.1_026723m)
Entry ID 9146
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: MePrx92 (cassava4.1_026723m)
Name (synonym) MePrx92 (cassava4.1_026723m)
Class Class III peroxidase     [Orthogroup: Prx199]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx92
start..stop
S start..stop
MePrx126 478 1e-171 1..337 1..321
MePrx109 454 3e-162 1..337 1..321
RcPrx85 454 3e-162 1..337 1..320
RcPrx77 449 5e-160 1..337 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 171917..172135 219 N° 2 171634..171825 192 N° 3 171356..171525 170 N° 4 170883..171311 429
complement(join(170883..171311,171356..171525,171634..171825,171917..172135))


exon

Literature and cross-references MePrx92 (cassava4.1_026723m)
DNA ref. Phytozome 12:   scaffold07035 (172135..170883)
Protein sequence: MePrx92 (cassava4.1_026723m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (311)
PWM (Da):   %s   36312.89 (33449.5)  
PI (pH):   %s   4.72 (4.64) Peptide Signal:   %s   cut: 27 range:27-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSRLSFSCMVLTILFMIFSSLPCQAQLSSNFYDNTCPNALSTIRSVIDTAVSREQRMAASLIRLHFHDCFVQGCDGSILLEDTASFTGERTARNNDQSVRGFEVIDDAKAQVESICPGIVSCADILAVAARDSSVAVGGPCWTVNLGRRDSTTASRTLADRDLPAFTDSLPILISKFENKDLNERDLVALSGLIIKKADILIEKLAGAHTIGQARCVTFRGRIYNNASDIDPDFASTRQSQCPTDSNGDGNLAPLDWRHPILSTTTTTRILLQEEDFLNQTRCFSxGGSTDSIVNEYSTDSSSFNSDFAAAMVKMGNIDPLTGSQGEIRRVCTAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. complement(join(170883..171311,171356..171525,171634..171825,171917..172135))
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGCTCTCGTTTATCTTTTTCTTGCATGGTTTTGACAATACTGTTTATGATTTTCTCAAGCTTGCCATGCCAAGCACAACTTTCTTCCAACTTCTATGACAACACGTGTCCTAATGCGC
TGAGTACTATTAGGTCAGTCATTGATACTGCAGTCTCGAGGGAGCAGAGAATGGCTGCTTCTCTCATTCGCCTTCATTTCCATGATTGCTTTGTTCAGG
TACGCAGTTCACGACAAATAT
AAGTTCGTATTCATTTTTGACGTATGCATTTTCTGGAAACTAATGTGATCAACTTGGCAATCATTGCAGGGTTGTGATGGCTCCATTTTGCTGGAAGATACAGCGTCATTTACTGGAGAA
AGAACTGCTCGAAACAATGACCAATCTGTGAGAGGATTCGAAGTCATAGATGATGCCAAGGCTCAAGTGGAGAGCATATGTCCTGGAATTGTTTCTTGTGCCGATATTCTTGCAGTCGCA
GCTCGCGATTCATCTGTTGCAG
TTAGTTTCTCTCTAAAACTAATTTTCCTGCNNNNNNNNNNNNNNNNNNNNNNNGCTAATATGATAATTAGGAGTTACTGATCTCAATTATTCATATAT
AAAAAACAGGTTGGTGGTCCATGTTGGACAGTAAATCTTGGAAGAAGAGATTCTACCACAGCTAGCAGAACTCTAGCTGATAGAGACCTTCCTGCATTTACAGATAGCCTCCCCATACTC
ATTTCTAAGTTCGAAAACAAAGATTTAAATGAAAGAGATCTGGTTGCCCTTTCAGGTTTG
TGCGTACGTCAAGAGTTATTATTATAATTATTTGCATGTGTAGAATTATTAAGAAGGCTG
ACATCTTAATTGAAAAACTTGCAGGAGCGCATACAATTGGACAAGCTAGATGTGTGACCTTCCGTGGTAGGATTTACAACAACGCAAGTGATATTGATCCTGATTTTGCTAGCACCCGAC
AAAGCCAATGTCCAACTGACAGTAATGGTGATGGAAATCTTGCACCACTTGATTGGAGACACCCAATACTTTCGACAACAACTACTACTCGAATCTTATTGCAAGAAGAGGACTTCTTGA
ATCAGACCAGGTGCTTTTCAGTNGGTGGATCTACAGATAGCATTGTTAATGAGTACAGCACAGACTCTTCATCTTTCAATTCTGATTTTGCAGCTGCCATGGTTAAGATGGGAAATATAG
ATCCACTTACTGGTTCTCAAGGAGAGATTCGCAGGGTTTGCACTGCTGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGCTCTCGTTTATCTTTTTCTTGCATGGTTTTGACAATACTGTTTATGATTTTCTCAAGCTTGCCATGCCAAGCACAACTTTCTTCCAACTTCTATGACAACACGTGTCCTAATGCGC
TGAGTACTATTAGGTCAGTCATTGATACTGCAGTCTCGAGGGAGCAGAGAATGGCTGCTTCTCTCATTCGCCTTCATTTCCATGATTGCTTTGTTCAGG
GTTGTGATGGCTCCATTTTGC
TGGAAGATACAGCGTCATTTACTGGAGAAAGAACTGCTCGAAACAATGACCAATCTGTGAGAGGATTCGAAGTCATAGATGATGCCAAGGCTCAAGTGGAGAGCATATGTCCTGGAATTG
TTTCTTGTGCCGATATTCTTGCAGTCGCAGCTCGCGATTCATCTGTTGCAG
TTGGTGGTCCATGTTGGACAGTAAATCTTGGAAGAAGAGATTCTACCACAGCTAGCAGAACTCTAGCTG
ATAGAGACCTTCCTGCATTTACAGATAGCCTCCCCATACTCATTTCTAAGTTCGAAAACAAAGATTTAAATGAAAGAGATCTGGTTGCCCTTTCAGGTTTG
ATTATTAAGAAGGCTGACA
TCTTAATTGAAAAACTTGCAGGAGCGCATACAATTGGACAAGCTAGATGTGTGACCTTCCGTGGTAGGATTTACAACAACGCAAGTGATATTGATCCTGATTTTGCTAGCACCCGACAAA
GCCAATGTCCAACTGACAGTAATGGTGATGGAAATCTTGCACCACTTGATTGGAGACACCCAATACTTTCGACAACAACTACTACTCGAATCTTATTGCAAGAAGAGGACTTCTTGAATC
AGACCAGGTGCTTTTCAGTNGGTGGATCTACAGATAGCATTGTTAATGAGTACAGCACAGACTCTTCATCTTTCAATTCTGATTTTGCAGCTGCCATGGTTAAGATGGGAAATATAGATC
CACTTACTGGTTCTCAAGGAGAGATTCGCAGGGTTTGCACTGCTGTCAAC

Retrieve as FASTA