Entry information : MePrx[P]131 (cassava4.1_031558m)
Entry ID 9152
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx[P]131 (cassava4.1_031558m)
Name (synonym) MePrx[P]131 (cassava4.1_031558m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx[P]131
start..stop
S start..stop
MePrx89 96 2e-25 5..108 79..235
RcPrx04 94 8e-25 5..110 73..231
MePrx80 93 3e-24 5..110 79..237
EguPrx121 89 1e-22 5..110 78..236
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 232046..232255 210 N° 2 231310..231429 120  
complement(join(231310..231429,232046..232255))


exon

Literature and cross-references MePrx[P]131 (cassava4.1_031558m)
DNA ref. Phytozome 12:   scaffold00080 (232255..231310)
Protein sequence: MePrx[P]131 (cassava4.1_031558m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   110
PWM (Da):   %s   12169.06  
PI (pH):   %s   5.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
NFDDCDASVLLKSTLGNPSQRDQPTIRAFKAIDEAKSQIAALCPSTVSCIHTLAFVAHGSSSKMRGTSYNELILLISYYFLFSELLYSFNEIHAQDQSMNSEYVVFIKIE

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (5', 3' and PS in frame are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATTTTGACGATTGTGACGCTTCAGTGCTGCTAAAATCCACACTAGGAAACCCGTCACAGAGAGACCAACCAACAATCCGAGCTTTCAAGGCGATCGATGAAGCCAAATCTCAAATTGCA
GCATTATGTCCAAGTACTGTGTCTTGTATACACACTCTAGCTTTTGTTGCTCATGGTAGCTCCTCCAAAATGCGAGGAACTAGTTATAAC
GTACCTTTATGATAATTATAGAATTAGGGA
GGGACAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNAAAATTAAAAAAAATCGAATCGATTAGTGATAATAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNGGTGTAAAAAATAAAAAGCTCAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTTTCTATCTAAAATCAATTCGATTCAATTTTCACAAATAC
TAAAATTTCAGTTTTTGATTTATTTGATTGAATTTAGTTTTGAATTAAATGCTCATAAAATTTGTATTCTCCATTGTTCAACATAAAGCAGTTTGCTCAAATTTTTAGAAAAAAAGGATA
TACATTGATGAGATGATTTTGTATTCTCCATTCTTCAACATAAAGCAGTTTGCTCAAATTTTTAGAAAAAAACGAATATACATTGATGAGATGATAGCAATCTCAGGAGCTCATTCTATT
GATCTCATATTACTTTTTATTTTCTGAGCTATTATATTCTTTCAATGAGATTCATGCACAAGATCAATCAATGAACTCTGAATATGTAGTCTTTATAAAGATCGAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATTTTGACGATTGTGACGCTTCAGTGCTGCTAAAATCCACACTAGGAAACCCGTCACAGAGAGACCAACCAACAATCCGAGCTTTCAAGGCGATCGATGAAGCCAAATCTCAAATTGCA
GCATTATGTCCAAGTACTGTGTCTTGTATACACACTCTAGCTTTTGTTGCTCATGGTAGCTCCTCCAAAATGCGAGGAACTAGTTATAAC
GAGCTCATTCTATTGATCTCATATTACTTT
TTATTTTCTGAGCTATTATATTCTTTCAATGAGATTCATGCACAAGATCAATCAATGAACTCTGAATATGTAGTCTTTATAAAGATCGAA

Retrieve as FASTA