Entry information : MePrx[P]56 (cassava4.1_020869m)
Entry ID 9153
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang LI)
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: MePrx[P]56 (cassava4.1_020869m)
Name (synonym) MePrx[P]56 (cassava4.1_020869m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx[P]56
start..stop
S start..stop
MePrx106 136 8e-41 1..111 1..137
RcPrx10 134 5e-40 1..109 1..135
MePrx122 132 2e-39 21..111 37..153
VvPrx31 130 1e-38 1..111 1..137
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 63883..64026 144 N° 2 64174..64362 189  
join(63883..64026,64174..64362)


exon

Literature and cross-references MePrx[P]56 (cassava4.1_020869m)
DNA ref. Phytozome 12:   scaffold03961 (63883..64362)
Protein sequence: MePrx[P]56 (cassava4.1_020869m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   111
PWM (Da):   %s   12012.21 Transmb domain:   %s   i7-24o
PI (pH):   %s   4.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDIQKLLSLLFSQLILVFLLLYLTNSQVLQLGFYDQSCPNAESTIHGVGCDGSVLLNSTSTNQAEKEALPNQTLRDFYVIDAIKSAVEKKWPGVVSCADILALAARDSVEL

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATATTCAAAAGCTTCTTTCACTTCTATTTTCTCAGCTGATTCTTGTCTTCCTGCTCTTATACCTAACAAATTCTCAAGTGTTACAACTAGGGTTCTATGACCAGTCATGCCCAAAT
GCAGAGAGTACCATCCATGGTGTG
GTTCAACAATTCATTTCCAAACAATTGCTGCCGCTTTACTGAGAATTAATTTTCATGATTGTATCGTTAGAGTATGTTTCCTACAAATTTATCTAT
AGTTATCACAATTCAACTTATATCGATGAACATGTTGCATGAACGTGACAGGGATGTGATGGTTCTGTGCTGTTAAATTCTACAAGCACCAATCAAGCTGAGAAAGAAGCACTCCCTAAC
CAAACCTTAAGAGATTTCTACGTGATTGATGCTATAAAATCTGCAGTAGAAAAGAAATGGCCTGGTGTGGTTTCTTGTGCTGATATTTTGGCTTTGGCAGCTAGAGATTCAGTTGAGCTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGATATTCAAAAGCTTCTTTCACTTCTATTTTCTCAGCTGATTCTTGTCTTCCTGCTCTTATACCTAACAAATTCTCAAGTGTTACAACTAGGGTTCTATGACCAGTCATGCCCAAAT
GCAGAGAGTACCATCCATGGTGTG
GGATGTGATGGTTCTGTGCTGTTAAATTCTACAAGCACCAATCAAGCTGAGAAAGAAGCACTCCCTAACCAAACCTTAAGAGATTTCTACGTGATT
GATGCTATAAAATCTGCAGTAGAAAAGAAATGGCCTGGTGTGGTTTCTTGTGCTGATATTTTGGCTTTGGCAGCTAGAGATTCAGTTGAGCTG

Retrieve as FASTA