Entry information : MePrx[P]59 (cassava4.1_021708m)
Entry ID 9154
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2012-01-05 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: MePrx[P]59 (cassava4.1_021708m)
Name (synonym) MePrx[P]59 (cassava4.1_021708m)
Class Class III peroxidase     [Orthogroup: Prx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx[P]59
start..stop
S start..stop
MePrx122 276 1e-94 1..170 154..343
RcPrx10 265 3e-90 1..170 138..327
PtPrx29 248 1e-83 1..170 138..327
PtPrx28 246 1e-82 1..170 138..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 226..391 166 N° 2 1017..1282 266 N° 3 1339..1416 78  
join(226..391,1017..1282,1339..1416)


exon

Literature and cross-references MePrx[P]59 (cassava4.1_021708m)
DNA ref. Phytozome 12:   scaffold10042 (226..1416)
Protein sequence: MePrx[P]59 (cassava4.1_021708m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18210.35  
PI (pH):   %s   9.97
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VGGPSWVVPTGRKDGRISLVSEASAQLPSPFANIDQLKQHFAAKGLNVKDLVVLSGAHTIGIGRCSTLNNRLYNFTRKGDTDPSLDPAYAAELKTKCKPGDTNTVVDMDPGSSKLFDSNYYSVVARRRGMFQSDAALPNDIQTSMVKMSKIGVLTGSLGEIRTRCAFVN

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (3' and 5' end are missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTGGTGGACCATCTTGGGTTGTTCCAACTGGACGTAAAGATGGAAGAATCTCTCTTGTTTCAGAGGCTTCAGCACAATTACCATCTCCCTTCGCCAATATCGACCAACTAAAGCAACAC
TTTGCTGCAAAGGGCTTAAATGTGAAGGACCTAGTGGTTCTATCTG
GTATCTACAGTTCATTTCCTTAGAAAAAAATACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNCACTACTATATTATCTTAAATTTGTGACTCATACTTTATTAGAATTCTTTTTTTTTTATTAGAGTGAGATTCTTAATTAAATTAAAGATGAAAAGTCTAACACAAGATTGTG
ATTGATAAATTATCTAGTTTTGTCCACATTGCATGGGTGGAAAAGGGTTCTTGGCAATTGATAAGGAGGGTTTTTAAGAGAATGACTTTTCTTTATTATATGGAAAGTGATTTTTACCAA
AGTAATGCAATACACGCAATGTAGAGAAAACTTTATTCATGTAGCTGGAGAAAAATTTTATTCATGTAGCTGAAGAAATTTTTATCGTGTATGNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAACGGCAAATAATAAATAGTTGATTGGATATAATTAGAATGATGGTAGATAATATGAACTTCTAATTGAATATTTT
ATTGAAATACATTAAAATTTGTGGGTAATTACCACAATATTATCGTTCCAAATACTCCTTTATATTCGCAGGCGCACACACCATTGGAATTGGACGTTGCTCCACACTCAATAATCGGCT
GTACAATTTCACTAGGAAAGGCGACACAGACCCCTCATTGGACCCAGCATACGCAGCTGAGTTGAAGACAAAATGTAAGCCTGGAGACACCAACACAGTTGTGGACATGGACCCTGGAAG
CTCCAAATTATTCGATAGCAATTACTACAGTGTTGTAGCTAGAAGAAGAGGGATGTTTCAATCTGATGCAGCTCTTCCCAATGATATCCAAACAAGA
GTTTGTCACTCTTCAGGCTTCAA
CAAAATGAATCACTTTCGCTCGTGATCTTGCTGTCGATGGTGAAAATGAGCAAAATTGGAGTCCTCACTGGCAGCCTGGGTGAAATTAGGACAAGGTGTGCCTTTGTAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTGGTGGACCATCTTGGGTTGTTCCAACTGGACGTAAAGATGGAAGAATCTCTCTTGTTTCAGAGGCTTCAGCACAATTACCATCTCCCTTCGCCAATATCGACCAACTAAAGCAACAC
TTTGCTGCAAAGGGCTTAAATGTGAAGGACCTAGTGGTTCTATCTG
GCGCACACACCATTGGAATTGGACGTTGCTCCACACTCAATAATCGGCTGTACAATTTCACTAGGAAAGGCGAC
ACAGACCCCTCATTGGACCCAGCATACGCAGCTGAGTTGAAGACAAAATGTAAGCCTGGAGACACCAACACAGTTGTGGACATGGACCCTGGAAGCTCCAAATTATTCGATAGCAATTAC
TACAGTGTTGTAGCTAGAAGAAGAGGGATGTTTCAATCTGATGCAGCTCTTCCCAATGATATCCAAACAAGA
TCGATGGTGAAAATGAGCAAAATTGGAGTCCTCACTGGCAGCCTGGGT
GAAATTAGGACAAGGTGTGCCTTTGTAAAC

Retrieve as FASTA