Entry information : MePrx[P]91 (cassava4.1_026515m)
Entry ID 9156
Creation 2011-07-01 (Qiang Li)
Last sequence changes 2011-11-30 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-01 (Qiang Li)
Peroxidase information: MePrx[P]91 (cassava4.1_026515m)
Name (synonym) MePrx[P]91 (cassava4.1_026515m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx[P]91
start..stop
S start..stop
MePrx17 182 2e-56 47..211 27..213
PtPrx52 181 3e-56 31..244 13..242
RcPrx44 175 9e-54 50..212 23..207
CsPrx39 170 9e-52 41..242 20..239
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 575267..575348 82 N° 2 575009..575062 54 N° 3 574369..574533 165 N° 4 573608..573696 89
N° 5 573539..573565 27 N° 6 573278..573445 168 N° 7 573217..573222 6 N° 8 573082..573186 105
complement(join(573082..573186,573217..573222,573278..573445,573539..573565,5736 08..573696,574369..574533,575009..575062,575267..575348))


exon

Literature and cross-references MePrx[P]91 (cassava4.1_026515m)
DNA ref. Phytozome 12:   scaffold03049 (575348..573082)
Protein sequence: MePrx[P]91 (cassava4.1_026515m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   246
PWM (Da):   %s   26219.42  
PI (pH):   %s   8.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMIIDGQRAETEDYTFSSNYHPSGSKSSGIHLQTNEIDGAVFAISVFAAAEASASLSFNFYDAIHQFKSIVTNTVRSASSSDPTIAGKLLRLVSHNYFCRGISALVLLQGNETKLSDPANQSLGAFFCYGLAPRDAGAIAGGSIIQIPKGRRDGRATTAANVRPNILDTSLTIVEIIKSFSSEESRVVLLI*VSGAHSVGAAHCSTFSAQFNSAQFNFLPILVPSPKQSLSRSKPNHQLIKCAVSHL*

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (3' end is missing; Stop in frame).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATTATTGATGGACAAAGAGCAGAAACTGAAGATTATACTTTTAGCTCAAATTACCACCCTAGTGGTTCTAAGTCATGTCAGTTTGCTTTGGGTTTTTCAATTTATAATGAATAC
CCGCTTCCACTGATTGGAATACTATTCTCCCAGCAAGTACCGTTGAGTGTCATATATATGTGATTAAAAACATTTACACACAATACTCTTCTCGCTCTCTCCTCTGTGTATCTCCAGTAT
TAATGGTAGCTGGAAATCTAGTGAAATTTTGAATTGTTAGTTTTAGCTGGCATTCACCTGCAAACGAATGAAATTGACGGAGCTGTCTTTGCTATATCAGGTAAGAGTTAGAATTTGATA
TTAGACATGACAAGGCCTTCAATGAGTCTAAGTTGTGTCCGGGTTAAATTAATTTAATAAATCATCATGAAGATTCAGCTGTTTTGGAACTCTGGTCGTAACTCTCAGTAGGGTGAACCA
GAAAAGTCAATACTAATAAATTGTCAATCCCAAATAGCAAGCAGCTTCGGTGAATTTTTATGGACAAGCAGATGAGGAAGAGGTTAATATGATGAGCCTCAATTTTCTATTGGTGACTGC
GAGACTAAAACCCCCCGTAAATGCATCTACAAATGCAGACATGTTTAGGTGGTCTCACCCCTGTTTGTCCCTTGAAGAGCTGAAATGCCTCGATTCTAAGACTAGAAGTGGTGTTCAAGA
CAGTAGCAAGCCACCCAAAATTGTCACGGAGACAACCATTAATATTTTCTTCTCTACCCATTTCTGTTAATTTTTCTCATTCTTGTTCTCTTCAGTCTTTGCTGCTGCCGAAGCTTCTGC
CAGCCTTTCTTTTAACTTCTATGATGCTATACATCAGTTTAAATCCATAGTTACAAACACAGTGAGATCAGCTTCCTCTTCTGATCCAACCATTGCAGGGAAGCTCCTCCGCTTGGTTTC
CCATAACTACTTTTGTCGAG
GTAACTTTCATCTAAATGCAGCAACAATTAGCATATTATACTTTCAAGAGATTGTTACAGTCGTTGAACCACATGTACAACTCTTATTGATCAATTGCTC
AATAAAGAAATGACCAAAATTGTGGCCAAAAAGATATTGCAATCCATTCGTTCTTGATACAATCTAGATATTGCACTACCAAGAATTTGTTCATGGATATAAGATTGCTCATGAGAAAAA
ATCTTCCTTATAAAATATTTACAAATGCCTGCGTCCAAAAAAGAATAGATTATCCGGTGCAGAGGCCTACTAAGGTTCTGTTTATCATTGTTGTTTAGAAAGCTGTCTGGAATAGCATCA
CCTTTAATATATTAGTCAGAGGTCATTGAAAATTGGTTTTAACTTAAATTTTTCACATATTGTGGTCATAAATACCTTAAAAAGACCAAACTGTTCTACAATTATTTTCGCTAACTGTTT
TTGTAATCGCAGTTCCAAATAGGCTCTAATCTATCAACAAAATCTTGACATCACCTTTGCACTCTAGACCGTGTATGATTGTCCAAAGTTTGGCACCATTGTTTTCCCCAATTACGCCAA
AGAAAACCCAATAATTATCCTGCAAACCAAAACGAAAATTGGTTTTATCATCACAGCAGAATATAAAACTGAAATGGTTGCAATGTTGTGCCGCATCAGTGCATTGGTGCTGCTACAAGG
AAACGAAACAAAGCTAAGTGATCCAGCAAACCAGTCTCTTGGAGCTTTTTTCTGTTATGGA
TTCAGCTAAAAGAATACTTGAACTAATCTGTCCAGGGACTGTTTAGCACCCAGAGATGC
TGGTGCCATT
GCAAGAATTCTGGCGTTCATGTTATTCCATTACTGTTTTATCTGCCTTTTTTCTTTTCTTTTTTTTTTGGTTGATTATTCTATATGCAAACAGATTGGAGGATCTATCAT
CCAGATTCCAAAAGGTAGGAGAGATGGGAGGGCAACAACAGCAGCAAATGTGAGACCTAATATTTTAGATACAAGTCTTACTATCGTTGAAATCATAAAAAGTTTCTCCTCTGAAGAATC
GAGAGTAGTTTTGTTAATTTGAGTTTCTGGC
TCTTTACTTTTCTATTCTGCTAGCGTGTGTGTATACAGGCTTTGCCATTGCACTTGCTCACAGTGTGGGAGCAGCTCACTGCAGCACAT
TCAGTGCTCAGTTCAATTTTCTACCAATTCTTGTCCCCTCTCCCAAACAGAGCCTTAGCCGTTCAAAGCCTAACCACCAGCTGATTAAATGTGCAGTTAGCCATCTT

Retrieve as FASTA