Entry information : SbPrx20 (Sobic.001G444500.1[2.1]Sb01g041770[1.4])
Entry ID 916
Creation 2008-10-15 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx20 (Sobic.001G444500.1[2.1]Sb01g041770[1.4])
Name (synonym) SbPrx20 (Sobic.001G444500.1[2.1]Sb01g041770[1.4])
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx20
start..stop
S start..stop
ZmPrx25 655 0 1..337 1..336
SiPrx145 627 0 3..337 4..340
ZmPrx138 589 0 8..337 1..326
OsPrx39 521 0 34..337 28..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 65020859..65021098 240 N° 2 65021251..65021442 192 N° 3 65022015..65022177 163 N° 4 65022289..65022707 419
join(65020859..65021098,65021251..65021442,65022015..65022177,65022289..65022707 )


exon

Literature and cross-references SbPrx20 (Sobic.001G444500.1[2.1]Sb01g041770[1.4])
Literature Klein,R.R. et al., An EST database from Sorghum: developing preanthesis pannicles. unpublished
DNA ref. Phytozome 12:   chromosome_1 (65020859..65022707)
EST ref. GenBank:   BG947415 [5' end]   BG947328 [3' end]
Protein sequence: SbPrx20 (Sobic.001G444500.1[2.1]Sb01g041770[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (312)
PWM (Da):   %s   36102.03 (33635.8)  
PI (pH):   %s   7.89 (7.68) Peptide Signal:   %s   cut: 26 range:26-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRGSSMACSLQLAVLMFAAVALGFGVRAGAAELCSEYYDQTCPDVHRVVRRVLKKAHEADVRIYASLTRLHFHDCFVQGCDGSILLDNSSSIVSEKFATPNNNSARGYPVVDAVKAALEEACPGVVSCADILAIAAKISVELSGGPRWRVPLGRRDGTTANITAANNLPSPFDNLTTLQQKFGAVGLDDTDLVALSGAHTFGRVQCQFVTARLYNFSGTNRPDPTLDRGYRAFLSLRCPRGGNASALNDLDPTTPDTFDNNYYTNVEARRGTLQSDQELLSTPGAPTAPIVGRFAGSQKEFFKSFTRSMINMGNIQVLTGSQGEIRNNCRVVNGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCCGTGGCAGCAGCATGGCCTGTAGTCTCCAGCTCGCCGTCCTCATGTTCGCCGCCGTCGCGCTCGGGTTCGGCGTCCGGGCCGGCGCGGCGGAGCTGTGCAGCGAGTACTAC
GACCAGACGTGCCCCGACGTGCACCGGGTGGTGCGGCGGGTGCTGAAGAAGGCGCACGAGGCCGACGTCCGCATCTACGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTGCAG
GTAAAAAAAAGCAGCCGGCCGGTCCCGTGTTCTGCAGACGGCCACGACGCCGGCCGGCTTCGGCGCTTGCCCTGCCCTGCCCGCGCCGCGCGCCGCACCACACATACGTACGTTCTGAGC
CGGCCGGCATGTGTTTATTTCTGGGTCGTCAGGGCTGCGACGGGTCCATCCTGCTGGACAACAGCTCGAGCATCGTGTCGGAGAAGTTCGCGACGCCCAACAACAACTCGGCGCGCGGGT
ACCCCGTGGTCGACGCCGTCAAGGCCGCGCTGGAGGAGGCCTGCCCTGGCGTCGTCTCCTGCGCTGACATACTGGCCATCGCCGCCAAGATCTCGGTCGAACTG
GTGAGTTTTTTCTAGC
CGGCCGGCAAATTAATGTCTACGCTAGCACCCATATATCGACCCACCGTTCCACCTCCATTCACAGAAGAATGTAATTCTACCTCAGTACACTAAGCTCGGTATCACCGTTAATGAGTTG
ATCTTGACAAAACGATCGACATTGTTCAAGACTTGACACACAGCAGCAAACAAACTGTCGGACTGGCGTTGTACAAGCTTTGCTTGCCTTGCCGGGAGGCAATAGCTATATATGGGCCTG
GAGCAATAATTCGAAAGCCGTCGGTGCCAAATAATTGAACTAGTAGTAGCTAGCTAGTATGGCCATATATTAGAGAGATCTATGAGAAGAAGTTGACAAAATTGCACGCCTTTTAAATGA
AAAGCATGCACAAACAGATAACCTACTTGTAGTCTAGTACAGTACGACGTGGATATTCACACGTCACATCTCGTCGGCTGTCATCAGCAGGGCGTTCGTTCGAAGCGCCAATCAGTTTCC
TTTCCGTGCCACGCTCTAATCCAACAAACACGGTCACATGACGCGTGGTCCCGTTCGTGTATGTACGTATGCGCAGTCCGGCGGGCCACGGTGGCGCGTTCCTCTTGGCCGGCGCGACGG
CACCACCGCCAACATCACCGCCGCCAACAACCTCCCGAGCCCCTTCGACAACCTCACCACGCTCCAGCAGAAGTTCGGCGCCGTCGGCCTCGACGACACCGACCTCGTCGCCCTCTCAG
G
TAATTAATTAATTAAGGGGTCCGGATCGGAGAAAACCACCGTGCATGCCCTGCAGCTGCACGACACAGAGATGATCGTGCCACCTCGCTCGGTGGATGCATTATTTGCAGGGGCGCACAC
GTTCGGGCGCGTGCAGTGCCAGTTCGTGACGGCGCGGCTGTACAACTTCAGCGGGACGAACCGGCCGGACCCGACGCTGGACAGGGGGTACCGGGCGTTCCTCTCGCTGCGGTGCCCGAG
GGGCGGCAACGCGTCGGCGCTGAACGACCTCGACCCGACCACGCCGGACACCTTCGACAACAACTACTACACCAACGTCGAGGCGCGCCGCGGGACGCTGCAGTCCGACCAGGAGCTGCT
GTCGACGCCCGGCGCGCCCACGGCGCCGATCGTCGGCCGGTTCGCCGGCAGCCAGAAGGAGTTCTTCAAGAGCTTCACCAGGTCCATGATCAACATGGGGAACATCCAGGTGCTGACGGG
GAGCCAGGGTGAGATCAGGAACAACTGCAGAGTGGTCAACGGAAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCCCGTGGCAGCAGCATGGCCTGTAGTCTCCAGCTCGCCGTCCTCATGTTCGCCGCCGTCGCGCTCGGGTTCGGCGTCCGGGCCGGCGCGGCGGAGCTGTGCAGCGAGTACTAC
GACCAGACGTGCCCCGACGTGCACCGGGTGGTGCGGCGGGTGCTGAAGAAGGCGCACGAGGCCGACGTCCGCATCTACGCCAGCCTCACCCGCCTCCACTTCCACGACTGCTTCGTGCAG
GGCTGCGACGGGTCCATCCTGCTGGACAACAGCTCGAGCATCGTGTCGGAGAAGTTCGCGACGCCCAACAACAACTCGGCGCGCGGGTACCCCGTGGTCGACGCCGTCAAGGCCGCGCTG
GAGGAGGCCTGCCCTGGCGTCGTCTCCTGCGCTGACATACTGGCCATCGCCGCCAAGATCTCGGTCGAACTG
TCCGGCGGGCCACGGTGGCGCGTTCCTCTTGGCCGGCGCGACGGCACC
ACCGCCAACATCACCGCCGCCAACAACCTCCCGAGCCCCTTCGACAACCTCACCACGCTCCAGCAGAAGTTCGGCGCCGTCGGCCTCGACGACACCGACCTCGTCGCCCTCTCAG
GGGCG
CACACGTTCGGGCGCGTGCAGTGCCAGTTCGTGACGGCGCGGCTGTACAACTTCAGCGGGACGAACCGGCCGGACCCGACGCTGGACAGGGGGTACCGGGCGTTCCTCTCGCTGCGGTGC
CCGAGGGGCGGCAACGCGTCGGCGCTGAACGACCTCGACCCGACCACGCCGGACACCTTCGACAACAACTACTACACCAACGTCGAGGCGCGCCGCGGGACGCTGCAGTCCGACCAGGAG
CTGCTGTCGACGCCCGGCGCGCCCACGGCGCCGATCGTCGGCCGGTTCGCCGGCAGCCAGAAGGAGTTCTTCAAGAGCTTCACCAGGTCCATGATCAACATGGGGAACATCCAGGTGCTG
ACGGGGAGCCAGGGTGAGATCAGGAACAACTGCAGAGTGGTCAACGGAAGCTAG

Retrieve as FASTA